SecReT6
Effector Protein ID: 153947260
-
SecReT6 ID223
T6SS typeA3
Gene symbol-
Locus tagYpsIP31758_1369
StrainYersinia pseudotuberculosis IP 31758
Repliconchromosome [GenBank: NC_009708] [Browse all T6SS(s) in this replicon]
Location [Strand]1605404..1605889 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDA7FGH0
KEGG IDypi:YpsIP31758_1369
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|153947260|ref|YP_001400348.1| hypothetical protein YpsIP31758_1369 [Yersinia pseudotuberculosis IP 31758]
MAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHSGSGGGSGKASVSDFCFAHYIDKASPNLL
SYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQN
AEGHKSGVISANYDVKANMHS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|153946813|ref|NC_009708.1|:1605404-1605889 Yersinia pseudotuberculosis IP 31758 chromosome, complete genome
ATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGCCAATCACAAAAACG
AAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGCGGTTCAGGTGGCGG
TTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTAGCCCGAACTTATTG
AGCTATTGCTTGCTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGCCGGTGGCGATCCGC
TGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCGGGTTCTTTGGAAGA
TGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACTATGTTATGCAGAAT
GCTGAAGGCCATAAATCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACATGCACAGCTAA