SecReT6
Effector Protein ID: 15595293
-
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA0095
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]115299..117524 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0095
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ9I737
KEGG IDpae:PA0095
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-89, Aligned region: 29..329
Phage_GPD [PF05954], Evalue: 2.90E-89, Aligned region: 346..380
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 514..534
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 529..552
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 537..560
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 554..576
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 562..584
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 586..608
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 594..616
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 610..632
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 633..656
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 658..675
Gp5_C [PF06715], Evalue: 4.20E-28, Aligned region: 715..731
Phage_base_V [PF04717], Evalue: 2.40E-26, Aligned region: 369..462
Protein Sequence: 741 a.a.     [Download]
>gi|15595293|ref|NP_248785.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MALAQQTRLVRVDSPLGAEVLQLQRMEGREELGRPFAYELELISENPDLPLDGLLGKPASLALELHDGSR
RHFHGIVAACSQGSGNGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYWFRHEQSRHILVLSDAYGAHQSPPNYASVPYYPPTLEQRER
DHFYDWHMAREVQSGSLSLNDYDFQRPGARLEVRSNIARSHAAADYPLYDYPGEYVQSQDGEQYARTRIE
ALQARYERVRLRGRARGLGSGHLFKLSGYPREDQNREYLVVGAEYRVVQELYETGGGGVGAQFESELDCI
DAGQAYRPLPTTPLPIVRGPQTAVVVGPKGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYELPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITIGVDRTEKVG
NNEKISIGANRTEDVGSNETISIGVDRTEKVGSNEKISIGANRTEDVGNDETISIGANRSESVGNNETIS
IGADRSESVGANETIDIGGNQSTSIGKNESRSVGQGRDTSVGKDDSLDVGKSFTLNAGDSITLVTGAASI
RMKKDGSIVISGKNITIDGSGAINVKADKNVVVKGRKILQN
-
Nucleotide Sequence: 2226 bp     [Download]
>gi|110645304|ref|NC_002516.2|:115299-117524 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGCACTTGCGCAACAGACCCGCCTGGTCCGGGTCGACAGTCCGCTCGGCGCGGAGGTCCTGCAATTGC
AGCGAATGGAGGGTCGCGAAGAGCTCGGCCGGCCGTTCGCCTACGAGCTGGAACTGATCTCGGAAAACCC
CGACCTGCCACTCGACGGGCTGCTGGGCAAGCCGGCCAGCCTGGCGCTGGAACTGCACGACGGCAGCCGG
CGGCATTTCCACGGCATCGTCGCCGCTTGCAGCCAGGGATCCGGCAACGGCCAGTTCGCCAGCTACCAGG
TCACCCTGCGCCCCTGGCTGTGGCTGCTGACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGT
CCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCC
TACCGCGAGTGGGAATACTGCGTGCAGTACCGCGAGACCAGTTTCGACTTCGTCAGCCGGCTGATGGAGC
AGGAAGGCATCTACTACTGGTTCCGCCACGAGCAGAGCCGCCACATCCTGGTGCTCTCCGACGCCTACGG
CGCGCACCAGAGCCCGCCGAACTACGCCAGCGTGCCCTACTACCCGCCGACCCTGGAACAGCGCGAGCGC
GACCATTTCTACGACTGGCACATGGCGCGCGAGGTGCAGTCCGGCTCGCTGAGCCTCAACGACTACGACT
TCCAGCGTCCCGGCGCGCGCCTGGAGGTGCGTTCGAACATCGCCCGCTCGCACGCGGCGGCCGACTACCC
GCTGTACGACTACCCCGGCGAATACGTGCAGAGCCAGGACGGCGAGCAGTACGCGCGGACCCGTATCGAA
GCCTTGCAGGCGCGCTACGAACGGGTGCGCCTGCGCGGCCGCGCCCGCGGCCTGGGTTCGGGCCACCTGT
TCAAGCTCAGCGGCTACCCGCGCGAGGACCAGAACCGCGAGTACCTGGTGGTCGGCGCCGAGTACCGGGT
GGTCCAGGAACTCTACGAGACCGGCGGCGGCGGGGTCGGCGCGCAGTTCGAGAGCGAGCTGGACTGCATC
GATGCCGGCCAGGCCTACCGCCCCTTGCCGACCACTCCGCTGCCGATCGTCCGTGGCCCGCAGACTGCGG
TGGTGGTCGGGCCCAAGGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCCACTG
GGATCGCCACGACCAGTCGAACGAGAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGGAAG
AACTGGGGTTCGATGCAGATCCCGCGGATCGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGG
ACCGGCCGATCATCACCGGGCGGGTCTACAACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGC
CACCCAGAGCGGGATGAAGAGCCGTTCGAGCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATG
GAGGACAAGAAGGGCGCCGAGCAGTTGTTCATCCATGCCGAGAAGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGGACCAAGACCATCGACCACGACGAGACCGTGCACGTGAAGCA
CGATCGCACCGAGACCGTGGACAACAACGAGACCATAACCATCGGCGTCGACCGCACCGAGAAGGTCGGC
AACAACGAGAAGATCAGTATCGGCGCGAACCGCACCGAGGACGTCGGCAGCAACGAGACCATCAGCATCG
GCGTCGACCGCACCGAGAAGGTCGGCAGCAACGAGAAGATCAGCATCGGTGCCAATCGCACCGAGGACGT
CGGCAACGACGAGACCATCAGCATCGGCGCGAACCGTAGCGAGTCGGTGGGCAACAACGAGACGATCAGC
ATCGGCGCCGACCGCAGCGAGTCGGTGGGCGCCAACGAGACCATCGACATAGGCGGCAACCAGAGCACCA
GCATCGGCAAGAACGAGTCGCGCAGCGTCGGCCAGGGCCGCGATACCTCGGTGGGCAAGGACGATAGCCT
GGACGTGGGCAAGAGCTTCACGCTCAACGCCGGCGACTCGATCACCCTGGTCACCGGTGCCGCCAGCATC
CGCATGAAGAAGGACGGCAGCATCGTCATCAGCGGCAAGAACATCACCATCGACGGATCCGGGGCGATCA
ACGTCAAGGCCGACAAGAACGTGGTGGTGAAGGGACGCAAGATCCTCCAGAACTGA

Reference
(1) Hachani A et al. (2011). Type VI secretion system in Pseudomonas aeruginosa: secretion and multimerization of VgrG proteins. J Biol Chem. 286(14):12317-27. [PudMed:21325275] experimental
 
experimental experimental literature