SecReT6
Effector Protein ID: 15595297
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA0099
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]120164..121324 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0099
DescriptionPA0099
UniProt IDQ9I733
KEGG IDpae:PA0099
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 8.40E-38, Aligned region: 19..134
Tox-GHH2 [PF15635], Evalue: 2.20E-33, Aligned region: 226..344
Protein Sequence: 386 a.a.     [Download]
>gi|15595297|ref|NP_248789.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MANEVYANNMEISCKAANGKSIAAFPDVCFTPPQAPPTPLGVPIPYPNTGLSKDTTKGTRTIRITRKEVM
LKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYFTSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPVWP
YLDQATVDAGGGPCSNEVKKEKKDCADFKPHGSKDACAGLGAGKPSGKKTSNEADRLADKVAARKCLTAR
RCALQPYKPNSCCPQQTAHHLIEASALHDKGRGGKGSVPLKGISNYSENKAPCVCAEGVNQNVGTHGLMH
TFQSAAAAKSRSGTLQLSNGSSISAKKTTYGTAKRQSMAAMGKVFPQSKCSKECLSAQLDNYHKQCGINA
RTPIKAVETGQTDVTAATQAIKTRNARLGATRSRVR
-
Nucleotide Sequence: 1161 bp     [Download]
>gi|110645304|ref|NC_002516.2|:120164-121324 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGCCAACGAGGTGTACGCCAACAACATGGAGATCTCCTGCAAGGCGGCGAACGGCAAGTCCATCGCGG
CCTTCCCGGATGTCTGCTTCACCCCGCCGCAGGCGCCGCCGACGCCGTTGGGGGTACCGATCCCCTACCC
CAATACCGGCCTGTCCAAGGACACCACCAAAGGCACCCGGACCATTCGCATCACCCGCAAGGAGGTGATG
CTGAAGAACAAGAGCTACTACAAGACCAGCTACGGCGACGAGCCGGGGCGGGCGCCGAAGAAGGGCATCG
TCACCAGCAAGATCAAGGGCAAGGTGTACTTCACCTCCTGGTCGATGAACGTCAAGTTCGAAAGCAAGAA
CGTGGTTCGCCACCTCGACCTGACCACCCACAACCACGCGTCCTTTCCTGGCAATACGCCGGTCTGGCCC
TACCTCGACCAGGCCACCGTCGATGCTGGTGGTGGACCGTGCAGCAATGAAGTGAAGAAGGAGAAGAAGG
ATTGCGCTGACTTCAAGCCGCATGGCAGCAAGGATGCCTGCGCTGGCCTTGGCGCGGGCAAGCCTTCCGG
CAAGAAGACCAGCAACGAAGCTGACCGACTGGCAGACAAGGTCGCTGCCCGAAAATGCCTGACCGCGCGC
CGGTGTGCCCTGCAACCGTACAAGCCGAACAGTTGCTGCCCGCAGCAGACCGCTCACCACCTGATCGAGG
CCAGCGCCTTGCACGACAAGGGACGTGGTGGAAAAGGCTCGGTACCCCTCAAGGGGATATCCAACTATTC
GGAGAACAAGGCTCCTTGCGTCTGCGCGGAGGGCGTCAATCAGAACGTGGGTACCCACGGCCTCATGCAC
ACGTTCCAGAGCGCCGCTGCCGCGAAGTCGCGCAGTGGAACCCTGCAATTGTCCAATGGCAGCTCCATCT
CCGCGAAGAAGACCACCTACGGAACGGCGAAACGTCAATCCATGGCTGCCATGGGCAAGGTCTTTCCGCA
GTCGAAATGCTCGAAGGAATGTCTGTCCGCTCAGCTCGACAACTATCACAAGCAGTGCGGAATCAACGCC
AGAACACCCATCAAGGCCGTTGAAACCGGCCAGACCGACGTCACGGCTGCGACGCAGGCGATAAAGACCC
GCAATGCGCGTCTTGGCGCCACGAGGAGTCGAGTCCGCTAG

Reference
(1) Hachani A et al. (2014). The VgrG proteins are "A la carte" delivery systems for bacterial type VI effectors. J Biol Chem. 289(25):17872-17884. [PudMed:24794869] experimental
 
experimental experimental literature