SecReT6
Effector Protein ID: 15595457
-
SecReT6 ID4
T6SS typeA1
Gene symbol-
Locus tagPA0260
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]291154..293304 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0260
DescriptionTle3
UniProt IDQ9I6M9
KEGG IDpae:PA0260
PDB IDNA
Domain hit(s) vs Pfam DUF3274 [PF11678], Evalue: 5.2e-109, Aligned region: 385-687
Protein Sequence: 716 a.a.     [Download]
>gi|15595457|ref|NP_248951.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MNDRVRSRTIVSAQSITLPKGGDVHLVPPPPKPCVTIVVHGVNDLAGCYERIERGLCQGLNERLDMPPTL
PGGQANPGYLTPAGYSLPADDEGKAENPDVVYYRRKFASGAGGAAVRSVVVPFYWGFREEEQYINKTAAH
GEWLDRNGNRLDKSGTKEGGQFVNATTNLPDMWGQGFNGKLFGFISLDWFGGTMTHPLFSAAGRKYMVLA
AMRLAMLIKIIRKRYPDDTINVVGHSQGTLLTLLAHAFLKDDGVAPADGVIMLNSPYGLFEPLNEKLQGW
SSQQTREARLATLKGILEFICGRRHPVPALSSVALRNCQGYGAIGGPGWVGGQGCQTTIDGERLSFDERD
NRGSVYLYFTPQDQTVGLANVQGIGWRGIAEQVKGLPGRTGLPQGFHQRIFTVRKRNGEKEKIGGHAPPH
VYPLLLAGEKTWEDTGLGGKDRFGRANFDQGDSVLLTAPRLPLPTEARFDFDGAVTAPGENSASGVYQVR
DTLDPIDAAIGVSNGGWKEKDSGHAVAQQVDAALAYRYGRDARSVERALNEGKELAQQTHVFSARELGTG
MVLVTRAETPYEARLRLQTAEGHLEPLSFHSAIPNNPEHNRRVLAYDLAIGAGDSVDDVVFYQYLCRVAD
WRLDWKASDKGIFSQGDASVDLPDEEVRALYRAEESKNSQLIDATVAYRKSGEFPVVVGNRLPSLVGTQT
ILDRYHEQAVRFGGTI
-
Nucleotide Sequence: 2151 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c293304-291154 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAACGATAGGGTTCGGTCGAGGACGATCGTCTCTGCCCAGTCCATCACCTTGCCCAAGGGCGGCGACG
TGCACCTGGTGCCGCCTCCGCCCAAGCCTTGCGTGACCATCGTGGTGCATGGCGTCAACGATCTCGCGGG
TTGCTACGAACGGATCGAGCGAGGGCTCTGCCAGGGGCTCAATGAACGCCTGGACATGCCGCCGACCTTG
CCCGGCGGGCAGGCCAATCCCGGCTACCTGACGCCGGCGGGCTACAGCCTGCCGGCGGACGACGAAGGCA
AGGCAGAGAACCCCGACGTCGTCTACTACCGGCGCAAGTTCGCCAGTGGCGCCGGCGGGGCCGCCGTACG
CAGCGTAGTCGTACCTTTCTACTGGGGCTTCCGCGAGGAAGAGCAATACATCAACAAGACCGCGGCCCAC
GGCGAATGGCTGGACCGCAACGGCAACCGGCTGGACAAGTCCGGCACCAAGGAAGGCGGGCAGTTCGTCA
ATGCCACCACCAACCTGCCGGACATGTGGGGCCAGGGTTTCAACGGCAAGCTGTTCGGTTTCATCTCGCT
GGACTGGTTCGGCGGCACCATGACCCATCCGCTGTTTTCGGCGGCAGGGCGCAAGTACATGGTCCTTGCG
GCCATGCGCCTGGCCATGTTGATCAAGATCATCCGCAAGCGTTACCCGGACGACACCATCAATGTCGTCG
GGCACAGCCAGGGCACCCTGTTGACCCTGCTGGCACATGCCTTCCTCAAGGATGACGGCGTGGCGCCGGC
GGACGGGGTGATCATGCTCAACTCACCCTACGGCCTGTTCGAACCCCTCAACGAGAAGCTCCAGGGCTGG
AGCAGCCAGCAGACCAGAGAGGCGCGGCTGGCCACGCTCAAAGGTATCCTCGAGTTCATCTGCGGCCGAC
GCCATCCGGTCCCCGCGCTGAGCAGCGTCGCGTTGCGCAACTGCCAAGGCTACGGCGCGATAGGCGGCCC
CGGCTGGGTGGGTGGCCAGGGCTGCCAGACGACCATCGACGGGGAACGGCTCAGCTTCGATGAGCGCGAC
AATCGCGGCAGTGTCTACCTGTATTTCACGCCCCAGGACCAGACGGTGGGACTTGCCAACGTCCAGGGTA
TCGGCTGGCGCGGCATTGCTGAGCAGGTCAAGGGGCTCCCGGGAAGGACCGGGCTGCCGCAGGGTTTTCA
CCAGCGCATCTTCACCGTACGCAAGCGCAATGGCGAGAAGGAAAAGATCGGCGGGCACGCCCCTCCCCAT
GTCTATCCTCTTCTGCTGGCCGGCGAGAAGACCTGGGAAGACACCGGGCTGGGCGGCAAGGACAGATTCG
GCCGGGCGAACTTCGACCAGGGCGACAGCGTGCTGCTGACTGCGCCGCGTCTGCCGTTGCCGACGGAAGC
GCGATTCGATTTCGACGGAGCCGTCACGGCGCCGGGAGAGAACTCCGCCAGCGGCGTCTATCAGGTGCGC
GATACCCTCGATCCGATCGACGCCGCCATCGGCGTAAGCAACGGCGGCTGGAAGGAAAAGGACAGCGGGC
ACGCCGTCGCGCAACAGGTGGACGCCGCGCTGGCGTACCGCTACGGGCGCGACGCGCGCAGCGTGGAGAG
GGCGTTGAACGAAGGCAAGGAATTGGCCCAGCAGACCCATGTGTTTTCCGCTCGTGAACTGGGCACCGGC
ATGGTTCTGGTCACCCGCGCGGAAACTCCCTACGAGGCCCGGCTGCGCCTGCAGACGGCGGAGGGCCATC
TGGAGCCCTTGTCGTTCCACTCGGCCATACCCAACAACCCGGAGCATAACCGGCGGGTACTGGCCTATGA
CCTGGCCATCGGGGCCGGGGACAGCGTGGATGATGTGGTTTTCTATCAGTATCTGTGTCGGGTGGCGGAT
TGGCGGTTGGATTGGAAGGCTTCGGACAAAGGAATATTTAGTCAAGGTGATGCGTCTGTTGATCTGCCGG
ATGAAGAGGTGCGTGCTTTGTACCGTGCGGAAGAGTCTAAAAACAGCCAGTTAATAGACGCCACCGTAGC
TTACCGCAAGAGTGGCGAGTTCCCTGTGGTAGTAGGAAATAGACTGCCTTCCCTAGTCGGGACACAAACC
ATCCTAGATCGTTACCACGAGCAGGCGGTGCGCTTTGGGGGGACAATCTAA

Reference
(1) Berni B, Soscia C, Djermoun S, Ize B, Bleves S (2019). A Type VI Secretion System Trans-Kingdom Effector Is Required for the Delivery of a Novel Antibacterial Toxin in Pseudomonas aeruginosa. Front Microbiol. 10:1218. [PudMed:31231326] experimental
 
experimental experimental literature