SecReT6
Effector Protein ID: 15595459
-
SecReT6 ID931
T6SS type
Gene symbol-
Locus tagPA0262
StrainEscherichia coli 17-2
RepliconT6SS [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]293802..296861 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPAO262
DescriptionVgrG2b is a novel antibacterial protease active in the periplasm,and VgrG2bC-ter metallopeptidase represents a hitherto-undescribed family of antibacterial T6SS effectors that appear to dysregulate the cell division process.
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1019 a.a.     [Download]
>gi|15595459|ref|NP_248953.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MRQRDLKFTFVVGEGKLAFDVVEFELEEALCEPFRLNLKLASDKNAIDFKQVLDQPGTFTLWQDGRPARY
VHGIVSHFTQGSSGFRRTRYELLLEPQLARLELCCNWRIFQEKSVPEILQALLKEHRVLDYEQRIYHEHL
PREYCVQAGDSDHYLHDRLAFEEGLVYYFRFDEHRHTLVCSDRLYVQERIAGGPVLFSAQPEGDNPQPVL
HSFRYSENVRTARQTQRDYSFKRPTYDQEHHLAGEALEHQGSSYERYDYPGRYKRSGAGRPFTESRLRGH
RRDARVASVSGDDPRLIPGHAFALEGHPRADFNAWWRPVRVVHRGTQYAGQEEESADAPLGVSYDLRAEL
VPEDVEWRPAPLPRPRIDGPQIATVVGPAGEEIHCDEWGRVKVQFPWDREGRHDEFSTCWIRVAQNWAGA
DWGHMAIPRIGQEVIVDYLDGDCDQPIVTGRTYRATNRPPYALPDHKILSTIKSKEYKGSRANELRIDDT
TAQISAALMSDHGASALHLGYLTHPRPEGGKPRGEGFELRTDEHGAVRAAKGLLLSTEEQLRAGAGHLDR
GVVVQVLEAALELARELGDYAGEHQGVGHDAAPQQTLQEAVRDLGHGANDESGKSNGGKPAIALSGPAGI
AAATPASLTLAAGEHVDSVARQNQQVTAGQKVVINAGSDIGLFAQGGELRQITHQGPMLLQAQKNDIRLE
AKQSVEVSASQQHVLVTAKEHITLMCGGAYLTLKGGNIELGMPGNFVVKAAKHSHVGAASLEAELPQFEV
GETQRRFVLKQLDGQTAMPNVPYTITMANGEVIEGVTDAEGATQLLQKDAMNIAKVDMKHTKSPASAVAG
IAAAVGAAVAVGKLLGGPDAEAGRALSEGEISLAKGVFGDSIDYSTVRLRDEDYVPWQGKDYVMAPNGHI
YFGEELRGVADWSLESLQRQGLFIHEMTHVWQHQHGVNVLLVGAYQQARQFLLGDQYAYRLEPGKTLKDY
NIEQQGDIVRDYFLEKNEFGEASANSRFAGVLKNFPTGY
-
Nucleotide Sequence: 3060 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c296861-293802 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGCGTCAAAGGGACCTGAAATTCACCTTCGTCGTCGGCGAAGGGAAACTCGCGTTCGATGTCGTCGAGT
TCGAACTGGAAGAAGCGCTCTGCGAGCCTTTCCGCCTGAACCTGAAGCTGGCCAGCGACAAGAACGCCAT
CGATTTCAAGCAGGTACTCGACCAGCCGGGCACCTTCACCCTCTGGCAGGACGGCCGTCCGGCCCGCTAC
GTCCATGGCATCGTCAGCCACTTCACCCAGGGCAGCTCGGGTTTTCGCCGGACCCGCTACGAACTGCTGC
TGGAACCGCAGTTGGCGCGCCTGGAGCTGTGCTGCAACTGGCGGATCTTCCAGGAGAAGAGTGTTCCGGA
GATTCTCCAGGCGCTGCTCAAGGAACACCGGGTGCTCGACTACGAACAGCGCATCTACCATGAGCACCTG
CCGCGCGAATACTGCGTGCAGGCCGGCGACAGCGATCACTACCTGCACGACCGGCTGGCTTTCGAGGAAG
GCCTGGTCTACTACTTCCGCTTCGACGAACACCGCCACACCCTGGTCTGCAGCGACCGGCTCTACGTCCA
GGAGCGTATCGCCGGCGGCCCGGTACTGTTCAGCGCCCAGCCGGAGGGCGACAACCCGCAGCCGGTGCTT
CATTCTTTCCGCTACAGCGAAAATGTTCGTACGGCTCGACAGACCCAGCGGGACTACAGCTTCAAGCGCC
CGACCTACGACCAGGAGCATCATCTCGCTGGCGAGGCGCTCGAGCATCAGGGCTCGTCCTACGAGCGCTA
CGACTACCCCGGTCGCTACAAGCGGAGCGGCGCCGGCCGGCCTTTCACCGAAAGCCGCCTCAGAGGGCAC
CGGCGCGATGCGCGGGTGGCATCGGTCAGCGGCGACGACCCGCGGCTGATCCCGGGCCACGCCTTTGCCC
TGGAAGGTCATCCGCGTGCCGACTTCAACGCCTGGTGGCGGCCGGTGCGGGTGGTCCATCGCGGCACCCA
GTATGCCGGCCAGGAGGAAGAGTCCGCCGACGCCCCTCTGGGGGTGAGCTACGACCTGCGCGCCGAACTG
GTACCCGAGGACGTCGAATGGCGTCCCGCACCGCTGCCTCGGCCGCGTATCGATGGTCCGCAGATCGCGA
CGGTAGTCGGCCCGGCAGGGGAAGAGATCCATTGCGACGAGTGGGGACGGGTGAAGGTCCAGTTCCCCTG
GGATCGCGAGGGACGTCACGATGAGTTCAGTACCTGCTGGATACGGGTCGCGCAGAACTGGGCAGGTGCC
GACTGGGGGCACATGGCGATCCCGCGGATTGGCCAGGAGGTGATCGTCGATTACCTGGACGGCGACTGCG
ACCAGCCGATCGTCACCGGGCGCACCTACCGGGCGACCAACCGACCGCCCTACGCGCTGCCCGACCACAA
GATCCTCAGCACCATCAAGAGCAAGGAGTACAAGGGCAGTCGGGCCAACGAGCTGCGCATCGACGACACC
ACGGCGCAGATCAGTGCGGCGCTGATGAGCGACCACGGTGCCAGCGCGCTGCACCTGGGCTACCTGACCC
ATCCTCGGCCCGAAGGCGGCAAGCCGCGCGGCGAGGGCTTCGAACTGCGCACCGACGAACATGGCGCGGT
GCGTGCGGCCAAGGGGCTGCTGCTGAGCACCGAGGAGCAGCTCAGGGCCGGCGCCGGCCATCTCGACCGA
GGCGTCGTGGTGCAGGTGCTGGAGGCCGCGCTGGAGCTGGCCCGCGAGCTGGGCGACTACGCCGGGGAGC
ACCAGGGCGTGGGGCACGACGCGGCGCCGCAGCAAACCCTCCAGGAAGCCGTGCGCGACCTCGGCCACGG
CGCCAACGACGAGTCCGGCAAGAGCAACGGGGGCAAGCCGGCGATCGCCTTGAGCGGTCCGGCAGGGATC
GCCGCGGCGACGCCGGCGAGCCTGACCCTGGCCGCCGGCGAGCACGTCGACAGCGTGGCCCGGCAGAACC
AGCAGGTGACCGCCGGGCAGAAGGTGGTGATCAACGCCGGCAGCGACATCGGCCTGTTCGCCCAGGGCGG
CGAGCTGCGCCAGATCACCCACCAGGGGCCGATGCTGCTGCAGGCGCAGAAGAACGACATCCGCCTGGAG
GCCAAGCAGAGCGTGGAGGTCAGCGCCAGCCAGCAGCACGTGCTGGTCACCGCGAAGGAGCACATCACCC
TGATGTGCGGCGGCGCCTACCTGACCCTCAAGGGCGGCAACATCGAGCTGGGCATGCCCGGCAACTTCGT
GGTCAAGGCGGCGAAGCACAGTCATGTCGGCGCGGCCAGCCTGGAAGCCGAGCTGCCGCAGTTCGAGGTG
GGCGAGACGCAGCGGCGGTTCGTCCTCAAGCAACTGGACGGGCAAACGGCCATGCCCAACGTGCCCTATA
CCATCACCATGGCCAACGGCGAGGTCATCGAGGGCGTCACCGACGCCGAAGGCGCTACCCAGCTGCTGCA
GAAGGATGCGATGAACATCGCCAAGGTCGATATGAAACACACGAAATCGCCCGCCTCCGCAGTTGCCGGG
ATAGCAGCGGCGGTTGGCGCGGCGGTTGCAGTCGGCAAGCTCCTGGGTGGCCCCGACGCCGAGGCCGGAC
GTGCTCTCAGCGAAGGGGAAATCAGCCTGGCGAAAGGCGTATTCGGCGATTCCATCGACTATTCCACGGT
CCGCCTGCGCGACGAGGACTATGTCCCCTGGCAGGGCAAGGACTACGTGATGGCGCCGAACGGCCACATC
TACTTCGGCGAGGAGTTGCGCGGCGTGGCGGACTGGAGCCTGGAGAGCCTGCAGCGCCAGGGTCTGTTCA
TTCACGAAATGACCCATGTCTGGCAGCACCAGCATGGCGTCAACGTCCTTCTGGTGGGGGCCTACCAGCA
AGCCAGGCAGTTTCTCCTAGGCGACCAGTACGCCTACCGGTTGGAGCCGGGAAAGACGTTGAAGGACTAC
AACATCGAACAGCAGGGAGACATCGTTCGAGATTATTTCCTCGAGAAGAACGAGTTCGGGGAAGCCTCTG
CGAACAGCAGGTTCGCTGGCGTACTGAAAAACTTCCCAACGGGATACTGA