SecReT6
Effector Protein ID: 15596707
-
SecReT6 ID4
T6SS typeA1
Gene symbol-
Locus tagPA1510
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1639791..1641500 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA1510
DescriptionTplE
UniProt IDQ9I3K2
KEGG IDpae:PA1510
PDB ID4R1D, 5H7Y
Domain hit(s) vs Pfam NA
Protein Sequence: 569 a.a.     [Download]
>gi|15596707|ref|NP_250201.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSSEPLEPNQDVIIPRSRDSLGRPVYKAQLTRTDNQSEKVALIRQTAPLPVIFIPGIMGTNLRNKADKSE
VWRPPNGLWPMDDLFASIGALWTWAWRGPKARQELLKAEQVEVDDQGTIDVGQSGLSEEAARLRGWGKVM
RSAYNPVMGLMERRLDNIVSRRELQAWWNDEALSPPGDQGEEQGKVGPIDEEELLRASRYQFDVWCAGYN
WLQSNRQSALDVRDYIENTVLPFYQKECGLDPEQMRRMKVILVTHSMGGLVARALTQLHGYERVLGVVHG
VQPATGSSTIYHHMRCGYEGIAQVVLGRNAGEVTAIVANSAGALELAPSAEYREGRPWLFLCDAQGQVLK
DIDGKPRAYPQNQDPYEEIYKNTTWYGLVPEQNSQYLDMSDKKEGLRVGPRDNFEDLIDSIANFHGELSA
AGYHSETYAHYGADDSRHSWRDLIWKGDPTPLETPGATLNDDENGTYNSWFRRGLPTIVQGPLETGNPLD
ASGSGGDETVPTDSGQAPALAGVKASFRHGSKGKGQANTKRGYEHQESYNDARAQWAALYGVIKITQLAD
WHPNDKGGT
-
Nucleotide Sequence: 1710 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c1641500-1639791 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAGCAGCGAACCGCTCGAGCCGAATCAGGATGTGATCATCCCTCGCTCTCGCGACAGTCTGGGACGGC
CTGTCTACAAGGCGCAGTTGACCCGTACCGACAACCAGAGCGAAAAGGTGGCACTGATTCGGCAGACCGC
TCCCCTGCCGGTGATCTTCATTCCGGGGATCATGGGAACCAACCTGCGCAACAAGGCAGATAAAAGCGAG
GTCTGGAGGCCGCCGAATGGTCTGTGGCCCATGGATGACCTGTTTGCCTCCATCGGTGCGTTGTGGACTT
GGGCCTGGAGGGGTCCAAAGGCCCGTCAGGAGCTCCTGAAGGCTGAGCAAGTAGAAGTCGATGACCAGGG
TACGATCGATGTCGGTCAATCTGGTTTGTCCGAAGAAGCTGCCCGCCTGCGCGGCTGGGGCAAGGTCATG
CGCAGTGCGTATAACCCGGTCATGGGATTAATGGAGAGGCGACTGGATAACATCGTCAGCCGGCGGGAAC
TCCAGGCATGGTGGAATGACGAAGCCCTCTCTCCTCCTGGAGATCAGGGTGAGGAGCAGGGAAAGGTTGG
GCCGATCGATGAAGAGGAATTGCTCAGGGCCAGCCGATACCAGTTCGATGTCTGGTGCGCCGGCTATAAC
TGGCTACAGTCCAACCGGCAGTCGGCGCTGGATGTACGCGACTATATCGAGAATACCGTGTTGCCTTTCT
ACCAAAAGGAGTGCGGTCTCGATCCCGAGCAGATGAGACGTATGAAGGTCATTCTGGTCACCCATTCGAT
GGGAGGGCTGGTGGCTCGCGCCCTGACGCAGTTGCACGGCTATGAGCGCGTATTGGGGGTGGTGCATGGC
GTACAACCTGCGACAGGTTCCTCGACCATCTACCATCATATGCGCTGTGGCTATGAAGGTATCGCACAGG
TCGTGCTGGGGCGAAATGCCGGTGAAGTGACAGCCATTGTCGCCAATTCGGCCGGCGCGCTGGAATTGGC
CCCTAGCGCGGAATACCGGGAAGGGCGTCCCTGGCTGTTTCTATGCGACGCGCAGGGGCAGGTGCTCAAG
GATATCGATGGAAAGCCTCGGGCTTATCCGCAGAATCAGGACCCTTATGAAGAGATATACAAGAACACTA
CGTGGTATGGATTGGTGCCTGAGCAAAATTCACAATATCTGGACATGTCAGACAAAAAAGAAGGTTTAAG
AGTTGGCCCCCGTGATAACTTTGAAGACTTGATAGATAGCATTGCTAATTTTCATGGTGAATTATCAGCA
GCAGGATATCACTCAGAGACCTATGCCCATTACGGAGCTGACGATAGCCGCCATAGTTGGCGCGACCTGA
TCTGGAAGGGTGACCCTACCCCTCTGGAGACCCCCGGTGCCACACTCAACGACGATGAGAACGGCACTTA
CAACAGTTGGTTCCGCCGGGGCTTGCCCACCATAGTGCAGGGTCCGCTGGAGACGGGAAATCCTCTGGAC
GCTTCCGGTAGCGGAGGTGACGAAACGGTACCGACCGACTCCGGCCAGGCGCCTGCCCTGGCGGGCGTCA
AGGCCAGCTTTCGGCATGGCAGCAAGGGCAAGGGACAGGCCAATACCAAACGGGGCTATGAGCACCAGGA
GAGTTACAACGATGCTCGTGCTCAATGGGCAGCGCTATATGGGGTGATCAAAATCACCCAGTTGGCGGAT
TGGCATCCTAATGACAAAGGAGGGACATGA

Reference
(1) Jiang F, Wang X, Wang B, Chen L, Zhao Z, Waterfield NR, Yang G, Jin Q (2016). The Pseudomonas aeruginosa Type VI Secretion PGAP1-like Effector Induces Host Autophagy by Activating Endoplasmic Reticulum Stress. Cell Rep. 16(6):1502-1509. [PudMed:27477276] experimental
 
experimental experimental literature