SecReT6
Effector Protein ID: 15597041
-
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA1844
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2003868..2004332 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA1844 (Tse1, Tae1)
DescriptionTse1(Tae1); peptidoglycan amidase
UniProt IDQ9I2Q1
KEGG IDpae:PA1844
PDB ID4FQB, 3VPI, 4FGD, 4FQA, 4EQ8, 4F0V, 4FGE, 3VPJ, 4EOB, 4F0W, 4FGI, 4F4M, 4EQA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00025, Aligned region: 29..97
CHAP [PF05257], Evalue: 0.00025, Aligned region: 103..130
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 23..98
NLPC_P60 [PF00877], Evalue: 0.0012, Aligned region: 134..153
Protein Sequence: 154 a.a.     [Download]
>gi|15597041|ref|NP_250535.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MDSLDQCIVNACKNSWDKSYLAGTPNKDNCSGFVQSVAAELGVPMPRGNANAMVDGLEQSWTKLASGAEA
AQKAAQGFLVIAGLKGRTYGHVAVVISGPLYRQKYPMCWCGSIAGAVGQSQGLKSVGQVWNRTDRDRLNY
YVYSLASCSLPRAS
-
Nucleotide Sequence: 465 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c2004332-2003868 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGACAGTCTCGATCAATGCATCGTCAACGCCTGCAAGAACAGCTGGGACAAGAGCTACCTGGCCGGCA
CCCCGAACAAGGACAACTGTTCCGGCTTCGTCCAGTCGGTGGCCGCCGAGCTGGGCGTACCGATGCCCCG
CGGCAACGCCAACGCCATGGTCGACGGCCTGGAGCAGAGCTGGACCAAGCTCGCCTCCGGCGCCGAGGCC
GCGCAGAAGGCGGCCCAGGGCTTCCTGGTGATCGCCGGCCTGAAGGGCCGCACCTACGGGCACGTCGCGG
TGGTCATCAGCGGTCCGCTGTATCGGCAGAAGTACCCGATGTGCTGGTGCGGCAGCATCGCCGGCGCGGT
CGGCCAGAGCCAGGGCCTGAAGTCGGTCGGCCAGGTGTGGAATCGCACCGACCGCGACCGCCTCAACTAC
TACGTCTACTCCCTGGCCAGTTGCAGCCTGCCCAGGGCCAGTTGA

Reference
(1) Russell AB et al. (2011). Type VI secretion delivers bacteriolytic effectors to target cells. Nature. 475(7356):343-7. [PudMed:21776080] experimental
(2) Hood RD et al. (2010). A type VI secretion system of Pseudomonas aeruginosa targets a toxin to bacteria. Cell Host Microbe. 7(1):25-37. [PudMed:20114026] experimental
 
experimental experimental literature