SecReT6
Effector Protein ID: 15597570
-
SecReT6 ID5
T6SS typeA4a
Gene symbol-
Locus tagPA2374
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2626221..2626757 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2374
DescriptionTseF
UniProt IDQ9I1A5
KEGG IDpae:PA2374
PDB IDNA
Domain hit(s) vs Pfam MORN_2 [PF07661], Evalue: 0.24, Aligned region: 48-69
MORN_2 [PF07661.13], Evalue: 0.0024, Aligned region: 96-117
MORN_2 [PF07661], Evalue: 0.25, Aligned region: 120-141
Protein Sequence: 178 a.a.     [Download]
>gi|15597570|ref|NP_251064.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MAASGKLDLVRGDSHLAGNLLDGSLEGPLRIDEHDRPQASLGYRQGQLHGASTLFHPNGKVSAQLAFVDG
KLHGPASFHAAEGWLQRKAHYRNGLLHGEAFNYFANGQVAEREHYRDGVRDGVYQRFHGNGQLAFDGRYL
NGQLLDGAQPFADDGRPLDSEGKPMARWRWWWTRLAEP
-
Nucleotide Sequence: 537 bp     [Download]
>gi|110645304|ref|NC_002516.2|:2626221-2626757 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGCGGCATCCGGCAAGCTCGACCTGGTTCGTGGCGACAGCCATCTCGCCGGCAACCTGCTCGACGGCA
GCCTGGAAGGCCCGTTGCGCATCGACGAGCACGACAGGCCGCAGGCCAGCCTCGGCTACCGGCAGGGCCA
GTTGCACGGCGCCAGCACCCTGTTCCATCCCAACGGCAAGGTCTCCGCGCAACTCGCCTTCGTCGACGGC
AAGCTGCACGGGCCGGCGAGTTTCCATGCCGCGGAAGGCTGGTTGCAGCGCAAGGCGCACTACCGCAACG
GGCTGCTCCACGGCGAAGCGTTCAACTATTTCGCCAACGGCCAGGTGGCCGAGCGCGAGCATTACCGCGA
CGGCGTGCGCGACGGGGTCTACCAGCGCTTCCATGGCAATGGCCAACTGGCCTTCGACGGACGCTACCTG
AACGGCCAGCTACTGGACGGCGCCCAGCCGTTCGCCGACGACGGCCGGCCGCTGGACAGCGAGGGCAAGC
CCATGGCGCGCTGGCGCTGGTGGTGGACCAGGCTGGCGGAGCCCTAG

Reference
(1) Lin J, Zhang W, Cheng J, Yang X, Zhu K, Wang Y, Wei G, Qian PY, Luo ZQ, Shen X (2017). A Pseudomonas T6SS effector recruits PQS-containing outer membrane vesicles for iron acquisition. Nat Commun. 28;8:14888. [PudMed:28348410] experimental
 
experimental experimental literature