SecReT6
Effector Protein ID: 15597880
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA2684
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]3031749..3035702 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2684 (Tse5)
DescriptionTse5
UniProt IDQ9I0F4
KEGG IDpae:PA2684
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 198..220
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 274..290
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 320..338
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 343..361
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 381..415
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 426..461
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 472..500
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 489..524
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 531..567
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 574..609
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 615..642
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 636..670
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 685..709
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 703..740
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 767..778
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 816..834
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 821..855
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 842..870
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 924..942
RHS_repeat [PF05593], Evalue: 2.30E-54, Aligned region: 948..981
RHS [PF03527], Evalue: 1.60E-16, Aligned region: 497..516
RHS [PF03527], Evalue: 1.60E-16, Aligned region: 1065..1104
Protein Sequence: 1317 a.a.     [Download]
>gi|15597880|ref|NP_251374.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSGLPVSHVGEKVSGGVISTGSPTVHVGSSAVGLADRVSACVPLVGKPVNPMLGSKLLPEEVDFALAAPD
TFTFARGYLSSNPRIGRLGRGWWLPGESMHLELSEDACVLVDAQGRRIGFPALAPGAQHYSGSEELWLRR
GGSSGGEAQAWRGRWAAVPAELQTQEGSVLVLSGHSYLHFQRCPDGIWRLQASFGRAGYRTEFRWSGRGL
LTGVRDSAGRSYALVYQQACEPSEGDDGLRLFGVILASHDGPPPDYIDPQSPGLDWLVRYQFSDSGDLIA
VRDRLGQVVRVFAWREHMLVAHGEPGGLEVRYEWDVHAPHGRVVKQIEAGGLTRTFRYLRDATEVSDSLG
RVERYEFAGEGGQRRWTALVRADGSRSEFDYDLFGRLVAMRDPLGRETRRRRDGQGRMLEEESPGKARYR
KRVDEETGLLVELEDAMQRRWTFERDERGNATTVRGPAGSTRYAYEDPRLPDRPTRIVDPRGGERRLEWN
RFGLLAALTDCSGQVWRYDYDNEGRLVASSDPLGQLTRRRYDPLGQLIGLELADGSALSYEYDALGRQTR
IADAEGHATLFSWGHGDLLARVSDAGGGELSYLHDEAGRLVALTNENGVQAQFRYDLLDRLVEETGFDGR
RQRYRYNAADELIAREDADGRETTYAYDRDGRLASIRVPATEHAPALVERYRWLADGRLASAGGADCEVR
YTYDEVGNLRLESQVHADGWVYSVEHSHDALGVRQTSRYGDAPPVAWLTYGPGHLHGALVGAVELAFERD
ALHREVRRDARRDGQDDALFTQERQHAPLGRLQRSRLRLAGGFDWQRGYRYDGLGQLVGIDDNQYPSVRY
EYDLGGRLLASRRAGAAASTYRYDAAGNRLEGVGEHAREDARQAFAENELYRSGFSRSETRASQAGEGPA
RWAGNRVERIAGNRYRFDALGNLVERIGADGERLRLAYDGAQRLVHLTRDYADGTRLEARYRYDALSRRI
AKVVLRDGVEQQVRFGWDGDRQCAEAFARELRTTVHEPGGFVPLLRLEQACEPDPPELLQLRQAFAAEGQ
PLPAQCVPALGEARIAFFHTDHLGTPLQLSDERGQLRWQGVPDDWRAVAPERQPGAQPIRFQGQYHDEES
GLYYNRYRYYLPEAGRYASQDPLGLGGGPNPYAYALNAPTLAYDPTGLIIPLVVIGAFAARAAIGAALGA
GIELGMQTGKQVLGQMKDNWDSDRDLTDIKWKCIDINWKHVGASAAIGTVAPGMLSTGKTVVQSAKAIRT
LSGQAANTANRAAKLAARKAAHADTIKKAVATQAAWQTGKQIVKCPLKDEEEECPPQ
-
Nucleotide Sequence: 3954 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c3035702-3031749 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAGCGGCCTACCGGTTTCCCATGTCGGCGAGAAAGTCTCGGGAGGGGTTATCTCCACCGGCTCGCCCA
CCGTGCACGTCGGCAGCAGCGCGGTCGGCCTGGCCGACCGGGTGTCCGCCTGCGTGCCGTTGGTGGGCAA
GCCGGTCAACCCGATGCTCGGCAGCAAGCTGCTGCCGGAAGAGGTCGATTTCGCCCTGGCGGCGCCGGAC
ACCTTCACCTTCGCCCGTGGCTACCTGTCGAGCAACCCCCGTATCGGCCGGCTCGGCCGGGGCTGGTGGC
TGCCGGGCGAGAGCATGCACCTGGAACTGAGCGAAGACGCCTGCGTGCTGGTCGACGCCCAGGGCCGCCG
GATCGGCTTTCCTGCGCTGGCTCCCGGCGCCCAGCATTATTCCGGCAGCGAGGAGCTGTGGCTGCGCCGC
GGCGGTTCGAGCGGCGGCGAAGCGCAGGCCTGGCGCGGGCGCTGGGCGGCGGTGCCGGCCGAACTGCAGA
CGCAGGAGGGCTCCGTGCTGGTGCTGTCCGGCCACAGCTACCTGCATTTCCAGCGTTGCCCCGACGGTAT
CTGGCGCCTGCAGGCCAGCTTCGGCCGCGCCGGCTACCGCACCGAGTTCCGCTGGAGCGGACGTGGCCTG
CTCACCGGCGTGCGCGACAGCGCCGGGCGCAGCTATGCGCTGGTCTACCAGCAAGCCTGCGAGCCGAGCG
AGGGCGACGACGGCCTGCGTCTGTTCGGCGTGATCCTGGCCAGCCACGACGGACCGCCTCCGGACTACAT
CGATCCGCAGAGCCCGGGGCTCGACTGGCTGGTGCGCTACCAGTTCAGCGACAGCGGCGATCTGATCGCC
GTGCGCGACCGTCTTGGCCAGGTGGTCCGGGTATTCGCCTGGCGCGAGCACATGCTGGTCGCCCACGGCG
AACCGGGCGGGCTGGAGGTTCGCTACGAGTGGGATGTCCATGCTCCGCACGGGCGGGTCGTGAAGCAGAT
CGAGGCGGGCGGCCTGACCCGTACCTTCCGCTACCTGCGCGATGCCACCGAGGTCAGCGACAGCCTCGGC
CGCGTCGAACGCTACGAGTTCGCCGGCGAGGGCGGGCAGCGGCGCTGGACCGCGCTGGTCAGGGCCGACG
GCAGCCGTAGCGAGTTCGACTACGACCTGTTCGGCCGCCTGGTCGCCATGCGCGATCCGCTGGGACGGGA
GACGCGGCGCCGGCGCGATGGCCAGGGGCGGATGCTCGAGGAGGAGTCGCCGGGCAAGGCGCGCTATCGC
AAGCGCGTCGACGAAGAGACCGGGCTGCTGGTCGAGCTGGAGGACGCGATGCAGCGCCGCTGGACCTTCG
AGCGCGACGAACGGGGCAATGCGACGACGGTGCGCGGCCCGGCCGGCAGCACCCGCTACGCCTACGAAGA
CCCGCGCCTGCCCGACCGGCCGACGCGAATCGTCGACCCGCGCGGCGGCGAGCGGCGCCTGGAGTGGAAC
CGCTTCGGCCTGTTGGCCGCGTTGACCGATTGTTCCGGCCAGGTCTGGCGTTACGACTACGACAACGAAG
GACGTTTGGTCGCCAGCAGCGACCCGCTGGGACAACTGACCCGGCGCCGCTACGACCCGCTGGGGCAACT
GATCGGCCTGGAATTGGCCGACGGCAGCGCCCTGAGCTATGAATACGACGCCCTTGGGCGGCAGACCCGT
ATCGCCGATGCCGAGGGGCACGCCACGCTGTTTTCCTGGGGGCACGGCGATCTGCTGGCGCGGGTTTCCG
ACGCCGGCGGCGGCGAATTGTCCTACCTGCACGACGAAGCCGGCAGGCTGGTCGCCCTGACCAACGAGAA
CGGCGTCCAGGCGCAGTTCCGCTACGACCTGCTGGACCGTCTGGTGGAAGAGACCGGCTTCGACGGTCGT
CGCCAACGCTATCGCTACAACGCCGCTGACGAACTGATCGCCCGCGAGGATGCCGACGGTCGCGAGACCA
CCTATGCCTACGACCGCGACGGCCGCCTGGCGAGCATCCGGGTTCCCGCCACCGAGCACGCACCGGCCCT
GGTCGAGCGTTACCGCTGGTTGGCCGACGGCCGCCTGGCCAGCGCCGGCGGGGCGGATTGCGAGGTGCGC
TACACGTACGACGAGGTCGGTAACCTGCGCCTGGAAAGCCAGGTACATGCCGACGGTTGGGTCTACAGCG
TCGAGCACAGCCACGACGCGCTAGGCGTGCGCCAGACCAGCCGCTACGGCGACGCGCCGCCGGTCGCCTG
GCTGACCTATGGCCCGGGTCATCTGCACGGCGCGCTGGTCGGTGCGGTCGAGCTGGCCTTCGAGCGCGAT
GCCCTGCACCGTGAGGTGCGTCGCGACGCCCGCCGCGACGGGCAGGATGACGCGTTGTTCACCCAGGAGC
GCCAGCACGCGCCGCTGGGACGCCTGCAGCGCAGCCGCCTGCGTCTGGCCGGCGGTTTCGACTGGCAGCG
CGGCTATCGCTACGACGGACTTGGACAACTGGTCGGCATCGACGACAACCAGTATCCGTCGGTGCGCTAC
GAATACGACCTCGGCGGTCGCCTGCTGGCCAGCCGGCGCGCTGGCGCGGCGGCCAGCACCTACCGCTACG
ATGCCGCCGGCAACCGCCTGGAGGGCGTCGGCGAGCACGCGCGCGAGGACGCTCGCCAGGCATTCGCCGA
GAACGAACTGTACCGCTCCGGTTTCAGTCGCTCCGAGACGCGCGCGAGCCAGGCCGGCGAAGGCCCGGCG
CGCTGGGCCGGCAACCGCGTGGAGAGGATCGCCGGCAACCGCTATCGCTTCGATGCGCTGGGCAACCTGG
TCGAGCGTATCGGCGCCGACGGCGAGCGCCTGCGCCTGGCCTACGACGGCGCGCAGCGCCTGGTCCATCT
GACGCGCGATTACGCCGACGGTACGCGGCTGGAGGCGCGCTACCGCTACGACGCGCTGTCGCGACGGATC
GCCAAGGTGGTGCTGCGCGACGGTGTCGAGCAGCAGGTGCGCTTCGGTTGGGACGGCGATCGCCAATGCG
CCGAAGCCTTTGCGCGGGAACTGCGCACCACCGTTCACGAACCGGGCGGTTTCGTCCCGTTGCTGCGCCT
GGAGCAGGCCTGCGAGCCCGATCCCCCGGAGCTGCTGCAACTGCGCCAGGCGTTCGCCGCCGAAGGCCAG
CCGCTGCCGGCGCAATGCGTGCCGGCGCTGGGCGAGGCGCGGATCGCTTTCTTCCACACCGATCACCTCG
GTACCCCCCTGCAGCTGAGCGACGAACGTGGCCAACTGCGTTGGCAGGGCGTTCCGGACGACTGGCGGGC
GGTAGCGCCGGAACGACAGCCGGGTGCGCAGCCGATCCGCTTCCAGGGGCAGTACCACGATGAGGAAAGC
GGCCTCTACTACAACCGCTACCGTTACTACCTGCCGGAAGCCGGGCGCTATGCCAGCCAGGACCCGCTCG
GCCTGGGCGGTGGCCCCAACCCCTATGCCTACGCGCTGAACGCGCCCACGCTGGCCTACGATCCCACCGG
CCTGATCATCCCGCTGGTGGTGATCGGCGCCTTCGCCGCCCGCGCCGCGATCGGAGCGGCGCTGGGCGCC
GGCATCGAGCTGGGGATGCAGACCGGCAAGCAGGTGCTGGGGCAGATGAAGGACAACTGGGACAGCGATC
GCGACCTCACCGATATCAAGTGGAAGTGCATCGACATCAACTGGAAACACGTCGGCGCCTCGGCGGCCAT
CGGCACCGTGGCGCCGGGCATGCTCAGCACCGGCAAGACCGTGGTGCAGTCCGCCAAGGCGATCAGGACC
CTTTCCGGACAGGCGGCCAACACCGCCAACCGCGCGGCCAAGCTGGCCGCGCGCAAGGCCGCCCATGCCG
ATACCATCAAGAAGGCCGTGGCCACCCAGGCCGCCTGGCAGACGGGCAAGCAGATCGTCAAATGCCCACT
GAAGGACGAAGAAGAGGAGTGTCCGCCGCAATGA

Reference
(1) Whitney JC et al. (2014). Genetically distinct pathways guide effector export through the type VI secretion system. Mol Microbiol. 92(3):529-42. [PudMed:24589350] experimental
 
experimental experimental literature