SecReT6
Effector Protein ID: 15597881
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA2685
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]3035752..3037932 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2685
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ9I0F3
KEGG IDpae:PA2685
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.10E-86, Aligned region: 66..366
Phage_GPD [PF05954], Evalue: 8.10E-86, Aligned region: 384..431
Phage_base_V [PF04717], Evalue: 7.50E-26, Aligned region: 406..499
Gp5_C [PF06715], Evalue: 6.10E-09, Aligned region: 551..571
Gp5_C [PF06715], Evalue: 6.10E-09, Aligned region: 566..588
Gp5_C [PF06715], Evalue: 6.10E-09, Aligned region: 574..597
Gp5_C [PF06715], Evalue: 6.10E-09, Aligned region: 590..612
Gp5_C [PF06715], Evalue: 6.10E-09, Aligned region: 642..652
Gp5_C [PF06715], Evalue: 6.10E-09, Aligned region: 657..671
DUF2345 [PF10106], Evalue: 4.80E-05, Aligned region: 682..720
Protein Sequence: 726 a.a.     [Download]
>gi|15597881|ref|NP_251375.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MAIGQPFATALGCTIIWRAAGALFGPPAAGDYQGRFPMLFSQHTRLVHVDSPLGPEVLQLQRLEGREELG
RLFSHELELVSSNPALPLDALLGKPMSLALELPGGSRRYFHGIVARCSQGAGAGQFASYQVTLRPWLWLL
TRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYREWEYCVQYRETSFDFVSRLMEQEGIYYWFRH
EKKRHILVLSDAYGAHHSPAGYTSVPYYPPSLGHRERDHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEV
RSNVGRAHAAADYPLYDYPGEYVQSQDGEHYARTRIEAIQTQYERVRLRGCARGIGAGHLFHLSNYPRLD
QNREYLVVGAEYRVVQELYETGNGGGGAQFESELDCIDAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEI
WTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGKNWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVY
NAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLFIHAERNQDIEVENDESHWVGHDR
TKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVDRNETVRIGMNKTETILMASLQNVGMGRMENVGL
GYSLNVGMMMNTVVGLNQSTQVMKKKTLSVGDSYEVSVGGSDDGSKITLDGQSITLGSQRIELTADREIL
LRCGQSTIRLTPGEIEILSPNVDINC
-
Nucleotide Sequence: 2181 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c3037932-3035752 Pseudomonas aeruginosa PAO1 chromosome, complete genome
GTGGCTATTGGCCAGCCTTTCGCGACGGCACTGGGTTGTACGATCATCTGGCGCGCTGCTGGCGCGTTGT
TCGGGCCGCCCGCCGCAGGTGACTATCAAGGAAGATTCCCCATGCTGTTCTCCCAACACACCCGCCTGGT
ACACGTGGACTCCCCGCTGGGACCCGAGGTCCTGCAACTGCAACGGCTGGAGGGTCGCGAAGAGCTGGGC
CGGCTGTTCAGCCACGAGCTCGAACTGGTCTCGAGCAATCCCGCCTTGCCTCTGGATGCCCTGTTGGGCA
AGCCGATGAGCCTCGCGCTGGAACTCCCCGGCGGCAGCCGGCGGTATTTCCACGGCATCGTCGCGCGCTG
TAGCCAGGGCGCCGGCGCCGGCCAGTTCGCCAGCTACCAGGTCACCCTGCGGCCCTGGCTGTGGCTGCTG
ACGCGCACCTCCGACTGCCGCATCTTCCAGAACCAGAAGGTCCCGGACATCATCAAGCAGGTGTTCCGCG
ACCTCGGCTTCTCCGACTTCGAGGACGCCCTGAGCCGCTCCTACCGCGAGTGGGAATACTGTGTGCAATA
CCGCGAGACCAGCTTCGATTTCGTCAGCCGGCTGATGGAGCAGGAAGGCATCTACTACTGGTTCCGCCAC
GAAAAGAAGCGCCACATCCTGGTGCTCTCCGATGCCTACGGCGCGCACCACAGCCCGGCCGGCTACACCA
GCGTGCCCTATTACCCGCCGAGCCTCGGCCATCGCGAGCGCGACCACTTCTTCGACTGGCACATGGCGCG
CGAGGTCCAGCCCGGCTCGCTGAGCCTCAACGACTACGACTTCCAGCGTCCCGGCACCCGCCTGGAAGTG
CGCTCCAATGTCGGGCGCGCCCATGCCGCGGCCGACTACCCGCTCTACGACTACCCTGGCGAGTATGTGC
AGAGTCAGGACGGCGAACACTATGCACGGACCCGCATCGAGGCGATCCAGACCCAGTACGAGCGAGTTCG
CCTGCGGGGATGCGCCAGGGGTATCGGGGCGGGCCATCTGTTCCACCTGAGCAACTACCCGCGCCTGGAC
CAGAACCGCGAATACCTGGTGGTTGGCGCCGAGTACCGGGTAGTCCAGGAACTCTACGAGACCGGTAATG
GCGGGGGCGGCGCGCAGTTCGAGAGCGAGCTGGACTGTATCGACGCCGGCCAGGCTTTCCGCCCCTTGCC
GTCGACCCCGGTGCCGGTGGTGCGCGGCCCGCAGACCGCGGTGGTGGTCGGGCCCAAGGGCGAGGAGATC
TGGACCGACCAGTATGGCCGGGTCAAGGTGCATTTCCACTGGGACCGCCACGACCAGTCCAACGAGAACA
GCTCCTGCTGGATGCGCGTCTCGCAGGCCTGGGCCGGGAAGAACTGGGGCTCGATCCAGATCCCGCGGAT
CGGCCAGGAAGTGATCGTCAGCTTCCTCGAAGGCGACCCGGACCGGCCGATCATCACCGGGCGGGTCTAC
AACGCCGAGCAGACGGTGCCCTACGAGCTGCCGGCGAACGCTACCCAGAGCGGCACCAAGAGCCGTTCGA
GCAAGGGCGGCACGCCGGCCAACTTCAACGAGATCCGCATGGAGGACAAGAAGGGCGCCGAGCAGTTGTT
CATCCATGCCGAGAGGAACCAGGACATCGAGGTCGAGAACGACGAGAGCCACTGGGTCGGCCACGACCGG
ACCAAGACCATCGACCACGACGAGACGGTGCATGTGAAGCACGATCGCACCGAGACCGTGGACAACAACG
AGACCATCACCGTGCATGCCAACCGCAGCAAGACGGTCGACCGCAACGAGACGGTCAGGATCGGCATGAA
CAAGACGGAAACCATCCTCATGGCCTCGTTGCAGAACGTCGGCATGGGGCGCATGGAAAACGTCGGGCTC
GGCTACAGCCTGAACGTCGGCATGATGATGAACACCGTGGTCGGGCTGAACCAGAGCACCCAGGTGATGA
AGAAGAAGACCTTGTCGGTGGGCGATAGCTACGAAGTGAGCGTGGGCGGCAGCGACGATGGCTCTAAGAT
CACCCTGGACGGTCAGAGCATCACCCTCGGCAGCCAGCGCATCGAGCTGACCGCCGACCGCGAGATCCTC
TTGCGCTGCGGCCAGAGCACGATCCGCCTGACGCCGGGGGAGATCGAGATCCTCTCGCCCAATGTCGATA
TCAACTGTTGA

Reference
(1) Hachani A et al. (2011). Type VI secretion system in Pseudomonas aeruginosa: secretion and multimerization of VgrG proteins. J Biol Chem. 286(14):12317-27. [PudMed:21325275] experimental
(2) Hood RD et al. (2010). A type VI secretion system of Pseudomonas aeruginosa targets a toxin to bacteria. Cell Host Microbe. 7(1):25-37. [PudMed:20114026] experimental
 
experimental experimental literature