SecReT6
Effector Protein ID: 15597898
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA2702
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]3056890..3057366 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2702 (Tse2)
DescriptionTse2; cytoplasmic-acting toxin
UniProt IDQ9I0E0
KEGG IDpae:PA2702
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 158 a.a.     [Download]
>gi|15597898|ref|NP_251392.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSYDYEKTSLTLYRAVFKANYDGDVGRYLHPDKELAEAAEVAPLLHPTFDSPNTPGVPARAPDIVAGRDG
LYAPDTGGTSVFDRAGVLRRADGDFVIPDGTDIPPDLKVKQDSYNKRLQATHYTIMPAKPMYREVLMGQL
DNFVRNAIRRQWEKARGL
-
Nucleotide Sequence: 477 bp     [Download]
>gi|110645304|ref|NC_002516.2|:3056890-3057366 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGTCCTACGACTACGAGAAAACCAGCCTCACCCTCTACCGGGCGGTATTCAAGGCCAACTACGACGGCG
ACGTCGGTCGCTACCTGCATCCCGACAAGGAACTCGCCGAGGCTGCGGAAGTCGCCCCGCTGCTGCATCC
GACCTTCGACAGCCCCAACACCCCTGGCGTCCCCGCCCGCGCGCCGGACATCGTCGCCGGCCGCGACGGC
CTCTACGCCCCGGACACCGGCGGCACCTCGGTGTTCGACCGCGCCGGCGTGCTGCGCCGCGCCGACGGCG
ACTTCGTGATACCCGACGGCACCGACATCCCGCCGGACCTTAAGGTGAAGCAGGACAGCTACAACAAGCG
CCTGCAAGCCACCCACTACACCATCATGCCGGCCAAGCCGATGTACCGGGAGGTCCTCATGGGCCAACTG
GACAACTTCGTGCGCAACGCCATCCGCCGCCAATGGGAAAAAGCCCGCGGGCTCTAG

Reference
(1) Russell AB et al. (2011). Type VI secretion delivers bacteriolytic effectors to target cells. Nature. 475(7356):343-7. [PudMed:21776080] experimental
(2) Hood RD et al. (2010). A type VI secretion system of Pseudomonas aeruginosa targets a toxin to bacteria. Cell Host Microbe. 7(1):25-37. [PudMed:20114026] experimental
 
experimental experimental literature