SecReT6
Effector Protein ID: 15597970
-
SecReT6 ID3
T6SS typeA3
Gene symbol-
Locus tagPA2774
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H1-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]3132229..3132816 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA2774 (Tse4)
DescriptionTse4
UniProt IDQ9I069
KEGG IDpae:PA2774
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 195 a.a.     [Download]
>gi|15597970|ref|NP_251464.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSQLPIPLPLNESRWRYVTASGGGMTVAFLAGSGGSITLLSPEGENVSFRYGGVGGGIGLGMRLPRFGKV
NLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMYVELGAGVIAGGSGTAILFGLDPKL
LAAVALASASPLTAALGASMSRQLLQSSRGALLMAGVNVGAQFGGGAAAYLGALF
-
Nucleotide Sequence: 588 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c3132816-3132229 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGTCGCAACTTCCCATTCCCTTGCCCCTCAACGAGAGTCGCTGGCGCTACGTGACGGCCAGTGGCGGAG
GCATGACCGTGGCCTTCCTGGCGGGTAGCGGCGGCTCCATCACGTTGCTCTCGCCGGAGGGTGAGAACGT
GTCCTTCCGCTATGGCGGGGTGGGCGGCGGGATCGGACTGGGCATGCGCCTGCCGCGCTTCGGCAAGGTC
AACCTCAATGTCAAGGGCAAGAGCGTTGGCGGGGCCGGTGCGCTGGAGGCGTTGCCGAGCACCGGAACCG
TCTTGGTCGCGGACGGCCTGGTGGGGCGCGACCTGTCCCGCGGCGACTTCACCGGGCCCTGCATGTACGT
CGAACTCGGCGCGGGAGTCATCGCCGGCGGTTCGGGCACGGCGATCCTCTTCGGCCTCGATCCCAAGCTG
CTGGCGGCGGTGGCGCTGGCGAGCGCCTCGCCATTGACCGCCGCGCTGGGCGCCAGCATGTCGCGGCAAT
TACTGCAATCGTCCCGTGGCGCCCTGTTGATGGCCGGGGTCAACGTCGGTGCACAGTTCGGCGGCGGCGC
GGCGGCTTACCTGGGGGCGTTGTTCTGA

Reference
(1) Whitney JC et al. (2014). Genetically distinct pathways guide effector export through the type VI secretion system. Mol Microbiol. 92(3):529-42. [PudMed:24589350] experimental
 
experimental experimental literature