SecReT6
Effector Protein ID: 15598683
pldA
SecReT6 ID4
T6SS typeA1
Gene symbolpldA
Locus tagPA3487
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]3902663..3905962 [+]
Productphospholipase D
Effector typeProtein
Homologous effectorPA3487 (Tle5)
DescriptionPldA; phospholipase
UniProt IDQ9HYC2
KEGG IDpae:PA3487
PDB IDNA
Domain hit(s) vs Pfam PLDc [PF00614], Evalue: 1.90E-17, Aligned region: 164..189
PLDc [PF00614], Evalue: 1.90E-17, Aligned region: 852..877
PLDc_2 [PF13091], Evalue: 5.70E-09, Aligned region: 155..183
PLDc_2 [PF13091], Evalue: 5.70E-09, Aligned region: 808..894
Protein Sequence: 1099 a.a.     [Download]
>gi|15598683|ref|NP_252177.1| pldA gene product [Pseudomonas aeruginosa PAO1]
MLQKKPYNGLHEKELNQINQQDGSPCVAISAPGCFIKGSNLFSEKRAGNRVRFFTTGRDYFSDLASALDS
ASSSIFITGWQVNYDVLLDGRRSLWQCLRQALERSPALKVYVMPWLSPSGSLGTYDFETMLAVFQLNAGL
EGGARAFCTPAIQQSDMQGLGVAFSHHQKSVVIDNRIGYVGGIDLAYGRRDDNDFSLDASGRRGNDAYNP
GLPHLGWMAEDEHVSSMGLMMATLFDLSRPLASLTLHAPTLRLSPFPHIAASDEPLLSIPLAPSRARALN
GAAYLSDLFRSPMLPSLQWLGRAYNSSKEGLDEGFERLDALRRQMVASSIRAIANLIADNLDALPIEPEL
ERRLRAWLEELRTAALNLPEALRIKSLLLINQWMSETELGQVLTLISGKGFEDIPQNLSGKAGELAGSLF
WTLHRLMQARAGGHQQPYRYLDEAPQPLASPDNARLAADQPRMPWQDVHCRIEGPSVYDLARNFIDRWNG
QQAYLAKTPALQDTALVRSALEAVMKWLNSLAAAAGLENYLDEKRNLRLELDPPTPCWINAPEQLPQEPE
VRRGGMTVQVLRSAAARMLEQEQAGRLGAGVNLPLQVGVSTEGVQSNCKDAMLLAISGAQQFIYIENQFF
QSEFGKEGEVFKDLPLSGPMASLRDVGSLRRDFVVRIRLEEALEQRDLWLLDWAEVEKIAQEPGTEARQF
LKSMLAMWGVNAQGWLTHKLGEAQHGLLNEIGEALARRIERAIQREHPFHVYLVLPVHPEGALNVPNIMH
QVHLTQQSLVFGEQSLVKRIQRQMALKALEGKSDPAQAREIIERKDARGRPVYEQQDWSRYLTLLNLRTW
AVLGGRVVTEQIYVHSKLLIADDRVAILGSANINDRSLQGERDSELAVMVRDSEPLTVRLDGKNDAIVGK
AIHQLRVNLWKKHFGLSQGPGGFVKPASELSAYLSIPAAQEAWEAIQTLAKENTRAYERTFNFIPQNISQ
TQLQLTPEPPKGFEDGFPASIWPTWAYRKPGELRAGGQLMEPMPYQEIFWRSSNLTSVKTFPPPNGVSGF
ITALPTSWTRGERNDSGLNLSILAHQDSRSLPTQVAMNGDSSAQGKHRT
-
Nucleotide Sequence: 3300 bp     [Download]
>gi|110645304|ref|NC_002516.2|:3902663-3905962 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGTTGCAGAAGAAGCCCTACAACGGCCTCCACGAAAAGGAACTCAACCAGATCAACCAGCAGGATGGCA
GCCCCTGCGTAGCCATTTCCGCACCGGGCTGTTTCATCAAGGGGTCCAACCTCTTTTCCGAAAAGCGGGC
CGGTAACCGGGTCCGCTTCTTCACCACCGGCCGGGACTACTTCAGCGACCTGGCCAGCGCCCTCGACAGC
GCCAGTTCGAGCATCTTCATCACCGGCTGGCAGGTCAACTACGACGTCCTCCTCGACGGCCGCCGCAGCC
TCTGGCAGTGCCTGCGCCAGGCGCTGGAGCGCTCGCCCGCGCTGAAGGTCTACGTGATGCCCTGGCTCAG
CCCTTCCGGCAGCCTCGGCACCTATGACTTCGAAACCATGCTCGCGGTGTTCCAGCTCAACGCCGGACTC
GAGGGCGGCGCGCGCGCCTTCTGTACGCCGGCGATCCAGCAGAGCGACATGCAGGGACTGGGCGTCGCCT
TCTCCCACCACCAGAAATCCGTGGTGATCGACAACCGCATCGGCTATGTCGGCGGGATCGACCTTGCCTA
TGGCCGTCGCGACGACAACGATTTCAGCCTCGACGCCTCCGGGCGCCGGGGCAACGACGCCTATAATCCC
GGCCTACCGCATCTTGGCTGGATGGCGGAGGACGAACACGTCAGCTCCATGGGCCTGATGATGGCCACCC
TGTTCGACCTTTCCAGGCCGCTCGCCAGCCTGACGCTGCATGCGCCCACCCTTCGCCTGTCGCCCTTCCC
GCACATCGCCGCCAGCGACGAACCGCTGCTGAGCATTCCCCTCGCACCCAGCCGCGCCCGCGCCCTCAAC
GGCGCCGCCTACCTTTCCGACCTGTTCCGCAGCCCGATGCTGCCCTCCCTGCAATGGCTCGGCCGCGCCT
ACAACAGCTCGAAAGAAGGCCTGGACGAAGGCTTCGAACGGCTCGATGCGCTCAGGCGGCAGATGGTCGC
CAGCAGCATCCGCGCCATTGCCAACCTGATCGCCGACAACCTCGACGCCCTGCCCATCGAGCCTGAACTC
GAACGCCGCCTGCGCGCCTGGCTGGAGGAACTGCGCACGGCCGCGCTCAACCTGCCGGAAGCCCTGCGGA
TCAAGAGCCTGCTCCTGATCAACCAGTGGATGAGCGAAACCGAACTGGGCCAGGTCCTGACCCTGATCAG
CGGCAAGGGCTTCGAAGATATCCCGCAGAACCTGAGCGGCAAGGCCGGCGAGTTGGCCGGCTCGCTGTTC
TGGACACTCCACAGGCTGATGCAGGCTCGCGCCGGAGGCCACCAGCAACCCTATCGCTACCTGGACGAAG
CGCCTCAGCCATTGGCCTCGCCGGACAACGCCCGGCTGGCCGCCGACCAGCCGCGCATGCCCTGGCAGGA
TGTGCATTGCCGCATCGAAGGGCCGTCGGTGTACGACCTGGCGCGCAACTTCATCGACCGCTGGAACGGC
CAGCAGGCCTACCTGGCCAAGACGCCGGCGCTACAGGATACGGCGCTGGTACGCAGCGCCCTGGAAGCCG
TGATGAAGTGGCTGAACAGCCTGGCCGCCGCCGCGGGATTGGAGAACTACCTGGACGAGAAGCGCAACCT
CCGGCTCGAACTGGACCCACCCACGCCCTGCTGGATCAACGCGCCGGAACAGTTGCCGCAAGAGCCGGAG
GTGCGCCGCGGCGGCATGACCGTACAGGTACTGCGCAGCGCCGCGGCGCGCATGCTCGAACAGGAGCAGG
CCGGCCGCCTCGGCGCGGGAGTGAACCTGCCCTTGCAGGTCGGCGTCTCCACCGAAGGAGTCCAGAGCAA
CTGCAAGGACGCCATGCTCCTGGCGATTTCCGGGGCGCAGCAGTTCATCTATATCGAGAACCAGTTCTTC
CAGAGCGAGTTCGGCAAGGAAGGCGAAGTTTTCAAGGATCTGCCCCTTTCAGGCCCCATGGCCAGTCTGC
GCGACGTTGGCAGCCTGCGACGCGACTTCGTCGTCCGGATACGCTTGGAGGAAGCCCTGGAGCAGCGCGA
CCTCTGGCTGCTGGACTGGGCCGAAGTGGAGAAGATCGCCCAGGAGCCTGGCACCGAGGCCCGCCAGTTC
CTCAAGTCGATGCTCGCCATGTGGGGCGTGAACGCCCAGGGCTGGCTCACCCACAAGCTCGGCGAAGCCC
AGCACGGCCTGCTCAACGAGATCGGCGAAGCCCTGGCGCGGCGCATCGAACGGGCCATCCAGCGCGAGCA
CCCGTTCCACGTCTACCTGGTCCTGCCGGTGCACCCGGAGGGCGCGCTGAACGTGCCGAACATCATGCAC
CAGGTGCACCTGACCCAGCAGAGCCTGGTGTTCGGCGAACAGAGCCTGGTCAAGCGCATTCAGCGGCAGA
TGGCGCTCAAGGCCCTGGAAGGCAAGTCCGACCCGGCCCAGGCCCGGGAAATCATCGAGCGCAAGGACGC
TCGCGGTCGCCCGGTCTACGAACAGCAGGACTGGAGCCGCTACCTGACCCTGCTCAACCTGCGCACCTGG
GCGGTGCTCGGCGGGCGGGTGGTCACCGAACAGATCTACGTGCACAGCAAGCTGCTGATCGCCGACGACC
GGGTGGCCATCCTCGGCAGCGCCAATATCAACGACCGCAGCCTGCAAGGCGAGCGCGACTCCGAGCTGGC
GGTGATGGTGCGCGACAGCGAGCCGCTGACGGTCAGGCTGGACGGCAAGAACGACGCCATCGTCGGCAAG
GCCATCCACCAGTTGCGGGTGAATTTGTGGAAGAAGCATTTTGGCTTGAGCCAGGGGCCAGGCGGTTTCG
TCAAGCCGGCCAGCGAGTTGAGTGCTTATCTGTCCATCCCGGCGGCTCAAGAGGCCTGGGAAGCTATACA
AACATTAGCCAAGGAGAATACTCGTGCCTATGAACGGACTTTCAATTTTATTCCCCAAAATATCAGCCAG
ACTCAACTGCAACTGACTCCAGAGCCGCCTAAAGGATTTGAGGACGGATTTCCCGCCTCCATATGGCCCA
CCTGGGCATACAGAAAACCTGGCGAGTTAAGGGCGGGCGGACAACTGATGGAGCCGATGCCATATCAGGA
AATCTTCTGGCGCTCATCTAATCTCACTTCGGTGAAAACCTTCCCACCACCCAACGGGGTTTCCGGTTTC
ATCACGGCTCTACCAACCAGTTGGACCCGTGGTGAGCGCAATGATTCTGGCTTGAATCTAAGCATCCTGG
CACATCAGGACAGCAGATCGCTTCCCACCCAGGTCGCCATGAATGGAGATAGCTCGGCACAAGGAAAGCA
TCGCACATGA

Reference
(1) Russell AB et al. (2013). Diverse type VI secretion phospholipases are functionally plastic antibacterial effectors. Nature. 496(7446):508-12. [PudMed:23552891] experimental
 
experimental experimental literature