SecReT6
Effector Protein ID: 15599102
-
SecReT6 ID5
T6SS typeA4a
Gene symbol-
Locus tagPA3907
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]4375230..4376015 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA3907
DescriptionPA3907 encodes a TOX-REase-5 effector.
UniProt IDQ9HXA6
KEGG IDpae:PA3907
PDB IDNA
Domain hit(s) vs Pfam Tox-REase-5 [PF15648], Evalue: 1.2e-21, Aligned region: 115-204
Protein Sequence: 261 a.a.     [Download]
>gi|15599102|ref|NP_252596.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSGIGALFRPLPRMGPRLPFELPAPPRPHLPMPAPRPLPRPAPGALPRPVPRPMPVPQTLPRTETGTLSR
DRTREAERDCSKSQGRDKDCVECPPSRGEMAIANNGKGHSMSDLSARYQQWVTNFPFPHEWFWSGTWWDG
FDEPRCTLLEAKANYAFLFVPLLGVPRPWARAKVKSDLLQKAEVHSDKARPTPPVFVEWHFLQRIVYEYC
AAEYLRMGLANLKAFWNPMPGTDEHDDYQETRAKEQEEMKRFCEENPGYCA
-
Nucleotide Sequence: 786 bp     [Download]
>gi|110645304|ref|NC_002516.2|:4375230-4376015 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAGCGGCATAGGCGCGCTTTTCCGACCGCTGCCCCGCATGGGTCCGCGGCTGCCCTTCGAACTACCCG
CGCCGCCCCGGCCGCACTTGCCGATGCCGGCGCCGCGCCCGCTGCCGCGACCGGCCCCCGGCGCACTGCC
CAGGCCGGTACCGCGTCCGATGCCGGTGCCGCAGACCCTGCCCAGGACCGAGACCGGCACGCTGAGCCGC
GACCGGACCCGGGAAGCCGAGCGCGATTGCAGCAAGAGCCAGGGCCGCGACAAGGACTGCGTGGAGTGCC
CGCCGTCCCGGGGCGAAATGGCCATCGCCAATAACGGCAAGGGCCACAGCATGTCGGACCTGTCCGCGCG
CTACCAGCAGTGGGTGACCAATTTCCCGTTTCCCCACGAATGGTTCTGGAGCGGCACCTGGTGGGACGGC
TTCGACGAGCCGCGCTGCACCCTGCTGGAGGCGAAGGCCAACTACGCCTTCCTGTTCGTCCCGCTGCTCG
GCGTGCCCAGGCCCTGGGCACGGGCCAAGGTGAAGTCGGACCTGCTGCAGAAGGCCGAGGTCCACAGCGA
CAAGGCCCGACCGACCCCGCCGGTGTTCGTCGAATGGCACTTCCTGCAGCGGATCGTCTACGAGTACTGC
GCCGCGGAGTACCTGCGCATGGGACTGGCCAACCTGAAGGCATTCTGGAATCCGATGCCGGGAACGGACG
AGCACGACGACTACCAGGAAACCCGCGCGAAGGAACAGGAAGAGATGAAAAGGTTTTGCGAAGAGAACCC
GGGGTATTGCGCATGA

Reference
(1) Burkinshaw BJ, Liang X, Wong M, Le ANH, Lam L, Dong TG (2018). A type VI secretion system effector delivery mechanism dependent on PAAR and a chaperone-co-chaperone complex. Nat Microbiol. 3(5):632-640. [PudMed:29632369] experimental
 
experimental experimental literature