SecReT6
Effector Protein ID: 15600789
-
SecReT6 ID2
T6SS typeA1
Gene symbol-
Locus tagVCA0018
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]20427..22511 [+]
ProductvgrG protein
Effector typeProtein
Homologous effectorVCA0018
Descriptiontype VI secretion system Vgr family protein
UniProt IDQ9KNE7
KEGG IDvch:VCA0018
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-64, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 208..227
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 374..467
Phage_Mu_Gp45 [PF06890], Evalue: 0.00087, Aligned region: 426..452
Phage_Mu_Gp45 [PF06890], Evalue: 0.00087, Aligned region: 569..618
DUF2345 [PF10106], Evalue: 0.0018, Aligned region: 575..617
Protein Sequence: 694 a.a.     [Download]
>gi|15600789|ref|NP_232419.1| vgrG protein [Vibrio cholerae O1 biovar El Tor str. N16961]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYQMQLASRVSNLTADQMVDKRAELKLY
RNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGIHDYA
FALKRDCVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALAGG
TMDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFS
QIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEEGGSGATTYN
NQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVSFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNEL
SFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDQHLTVENDQFTQIKHNQHLTVEGESRTLVKLDCSSE
IGGSLQQKIGSKAIYDAGTEVHLKAGNKLVLEAGNELTIKAGGSFIKVDAGGVHVVGSAINLNSGGSAGS
GSGYGGKMAELPQGVDKAKTPQEIELAAVTPTQQSMSPLLKARQIEALKGPAPVCEVCEEAKGN
-
Nucleotide Sequence: 2085 bp     [Download]
>gi|15600771|ref|NC_002506.1|:20427-22511 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTTC
ACGGGCAGGAGTCACTCTCCAACAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTATCAAATGCA
ACTGGCGAGTCGGGTATCCAATCTGACTGCCGACCAGATGGTCGATAAGCGTGCTGAGCTCAAGCTTTAC
CGCAACTCACAATTGGTGCAGCGTGTGCACGGCATTGTACGTGCCTTTAGCCAAGGCGATATCGGCCATC
ACCACACCTTCTACCAACTCACTTTAGTGCCTGCCTTAGAGCGCTTATCCCTGCGCCACAATAGCCGCAT
TTTCCAAAAGCAGACTGTTCCAGAAATTCTCTCTATCTTGCTGCAAGAGATGGGCATCCACGATTACGCT
TTTGCGCTCAAACGTGATTGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGTGAAAGTGATATCGACTTTC
TGCACCGCCTCGCCGCTGAAGAAGGCTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGACAGCCTAAGTAAACTGCCGGAGCCCATCCCGTACAACGCCTTAGCGGGCGGC
ACGATGGATACACCGTACATCCACGGCTTAACCTATCGCACCCAAGCGGAAGTGAGCGAAGTTCAGCTCA
AAGATTACAGCTTCAAAAAGCCGGCGTACTCGTTTTTACAAACCGTGCAGGGTACTGAGCTGGATTATCA
GCAAACGCGCTACCAACATTTTGATGCGCCGGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGC
CAAATCCGTTTAGACTACCTGCGCCGCCATGCCCACACCGCAACAGGGCAGAGCAACGAGCCGCTGCTGC
GTGCCGGCTATAAGTTTGACCTGCAAGAGCATCTTGACCCTGCGATGAACCGCGATTGGGTGGTGGTCTC
TATTAACCATCAAGGTGAGCAGCCGCAAGCGTTACAAGAAGAGGGCGGCAGTGGTGCAACGACCTACAAC
AACCAGTTCAGCTTAATTCCAGGGCATCTCCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATAGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACACGGGCGGGTGAA
AATCCATTTTCCGTGGGACCGCTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAA
GGTTGGGCGGGCAGTCAGTATGGCTTTATCGCTATTCCGCGCATCGGTCATGAAGTGATTGTTTCTTTCT
TAAATGGCGACCCAGACCAACCGATTATCACTGGCCGCACCTATCATGCGACCAATACGCCGCCATACAC
TTTGCCAGAGCACAAAACCAAAACCGTGCTGCGCACCGAGACGCACCAAGGGGAAGGGTTTAACGAGCTC
AGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAAAGACTTCGATGGTTTGATTG
AAAACGACCACACCACGGTCATTCGCCACGACCAACACCTGACCGTTGAAAACGACCAGTTCACTCAGAT
TAAGCACAACCAACACCTGACGGTCGAGGGGGAGAGTCGTACGCTCGTCAAACTCGACTGCAGCAGCGAA
ATCGGCGGTTCATTGCAGCAAAAAATCGGCAGCAAAGCGATTTACGATGCAGGCACAGAGGTTCACCTTA
AAGCGGGTAACAAACTGGTCTTGGAAGCAGGCAACGAGCTTACCATCAAAGCCGGCGGCAGTTTTATTAA
AGTCGATGCTGGCGGTGTGCACGTCGTCGGCTCTGCTATTAACCTCAACTCCGGCGGCAGCGCAGGCAGC
GGCTCAGGCTATGGCGGTAAAATGGCCGAGTTGCCACAAGGGGTGGATAAAGCCAAAACGCCGCAAGAGA
TTGAGCTAGCCGCGGTAACTCCCACTCAGCAGTCTATGTCGCCTTTACTTAAGGCGCGACAAATTGAAGC
ACTCAAAGGTCCTGCACCTGTGTGTGAAGTGTGTGAAGAGGCCAAGGGAAATTAA

Reference
(1) Miyata ST et al. (2011). Vibrio cholerae requires the type VI secretion system virulence factor VasX to kill Dictyostelium discoideum. Infect Immun. 79(7):2941-9. [PudMed:21555399] experimental
 
experimental experimental literature