SecReT6
Effector Protein ID: 15600791
-
SecReT6 ID2
T6SS typeA1
Gene symbol-
Locus tagVCA0020
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]23395..26652 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0020 (VasX)
DescriptionVasX protein; Membrane Pore Forming; bacterial colicin-like effector; required to kill Dictyostelium discoideum
UniProt IDQ9KNE5
KEGG IDvch:VCA0020
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 1085 a.a.     [Download]
>gi|15600791|ref|NP_232421.1| hypothetical protein VCA0020 [Vibrio cholerae O1 biovar El Tor str. N16961]
MSNPNQAAKTGQTNDAQNPASACPFKQPLIGIIPVRYAFDVYDDQGQALHPLPKADRQWKGQFSIKQRSY
TLRQLRDGWLYVYDETAKTLHEYEVVGCKLTKIDWSDDEANKPTHERGSKGESKSCLLYPAQHTLSIGYA
HQRWTWRVCEHMRSNTSSRHAVMRKVSLKQFESNGTHPHAHFAQYLEDYVADIGTPAEQDIFKDTCTPSL
PVEKSEEAVKGTEFKFVADKAVVSSSDYLQDLPEQNCGLFVALNDPLADVSDLFVTFTTQVAKRTKAIGD
ETQQHKMQMAELTRTLGRIRLEEKEIPDFVKQDPIRILELERAITEYCATAKLAEIESHHLASEGHSPSG
NYALMQQQAEQKLAELKTLYRFEPTSAQMRKWRKKDNSFIDEVRWADLDNFLVEHYTELKGLDEQIKQHY
AQFMSAFNQLGLDPLLFGMDNQDEVQQAYLLALTSQFLVVVTQVNHDEKSLEILKKDLSFDSPKNLMALA
STGFSLQANQAINNHIQGFSTAFLSTSNPSDMVAFATAIANWDTFTGDERIQEKAWFKRWIEPAQSSFGA
LQKAVANQAKESWQAVMELLFPYQNQPKGGTPSLLANLRLLLVESLVREEAVLQHNPKYAAELKQFETKL
NAILQEMNDALELKPGNVSPKNHQIATAQSAQRKLGQLLSSELPMMLTLKNQAAMNTFQQSVNEKLSALS
KNVKTSSASVSQKLGGLGGLLFALNLWNTMTVLENIRYKVAQYPSWNPFKNPALGEAIYATGNTIVVAGA
ISAGRAWVTIAEQGLLDRTLKNALNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSK
TDLERFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILTNVFKR
SELEIWLSKSTWGKESAHWPVGKELTELEHLLHRPSLRLSQVTQRKAAQWMDSGSLQWQLELTLPDYLKG
QTIGLQITRLPAQPAYYQPQREAVTPILINEQQGKWSIEDNQPVYRITLGGSEKDTVGVCVALPLRWGKE
LSLKFYASGTRAGELDLQSAEANDIATRNLVVGKG
-
Nucleotide Sequence: 3258 bp     [Download]
>gi|15600771|ref|NC_002506.1|:23395-26652 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGAGTAATCCCAATCAAGCTGCGAAAACAGGACAGACCAATGATGCGCAAAATCCCGCCAGTGCATGTC
CTTTTAAACAGCCGTTAATAGGGATAATTCCTGTTCGTTACGCCTTTGATGTTTATGATGATCAAGGTCA
AGCATTACATCCTTTACCCAAAGCGGATCGACAGTGGAAAGGTCAATTCTCTATCAAGCAGCGCAGTTAC
ACTTTAAGGCAACTGCGTGATGGCTGGCTCTATGTCTATGATGAAACAGCAAAAACACTGCACGAATATG
AAGTCGTTGGCTGCAAGTTGACCAAAATTGATTGGTCTGATGATGAGGCAAACAAACCCACTCACGAGCG
CGGTTCGAAAGGTGAAAGCAAAAGCTGTTTACTCTATCCCGCCCAGCACACGCTCTCTATCGGTTATGCG
CATCAACGATGGACGTGGCGAGTGTGTGAGCATATGCGCTCCAATACCAGCAGCCGTCATGCTGTGATGC
GTAAAGTGAGCCTTAAACAGTTTGAGTCCAATGGTACTCACCCTCATGCACATTTTGCTCAGTATCTTGA
AGACTATGTGGCGGACATCGGGACGCCAGCTGAGCAGGATATTTTTAAAGATACCTGTACCCCTTCATTA
CCGGTAGAGAAAAGTGAAGAAGCGGTGAAAGGTACGGAATTCAAATTCGTTGCCGACAAAGCGGTGGTAA
GCAGCAGTGATTATTTGCAAGATTTGCCGGAGCAAAACTGCGGTTTATTTGTGGCGCTGAATGACCCTTT
AGCGGATGTGTCAGATTTATTTGTTACTTTTACTACCCAAGTGGCAAAGCGAACTAAAGCGATTGGTGAT
GAAACGCAACAGCATAAAATGCAGATGGCAGAGCTGACACGCACATTAGGCCGAATTCGTCTTGAAGAAA
AAGAAATTCCCGATTTTGTAAAACAAGATCCGATCCGTATTTTAGAGCTAGAAAGAGCCATTACTGAATA
TTGTGCTACGGCAAAATTGGCCGAAATCGAATCTCATCATTTAGCCAGTGAAGGGCATTCCCCATCGGGA
AACTATGCCTTGATGCAGCAGCAAGCGGAGCAGAAACTGGCGGAATTGAAAACACTCTATCGCTTTGAAC
CCACCAGTGCTCAGATGCGCAAGTGGCGCAAAAAAGACAACAGCTTTATTGATGAAGTGCGTTGGGCGGA
TTTAGATAACTTTTTGGTGGAGCATTACACCGAGCTCAAAGGATTGGATGAACAGATTAAACAACACTAT
GCGCAGTTTATGTCTGCCTTCAACCAGCTCGGCCTTGACCCGCTTCTGTTTGGTATGGATAACCAAGATG
AGGTTCAGCAAGCGTATTTGTTAGCATTAACTAGCCAATTTTTAGTGGTGGTTACGCAAGTCAATCATGA
TGAAAAATCGCTTGAGATCCTAAAAAAAGATCTCAGTTTTGATTCACCGAAAAACCTCATGGCCCTCGCG
TCAACAGGCTTTTCCCTGCAGGCAAATCAAGCCATTAACAACCATATCCAAGGGTTTAGCACCGCTTTTC
TCTCTACAAGTAATCCTAGTGATATGGTGGCGTTTGCGACCGCAATCGCTAACTGGGATACGTTCACGGG
GGATGAACGTATTCAGGAGAAAGCATGGTTTAAGAGATGGATTGAACCCGCTCAATCGAGTTTTGGTGCA
CTGCAAAAAGCGGTCGCCAATCAAGCCAAAGAGAGTTGGCAAGCGGTGATGGAGTTGCTGTTTCCTTATC
AGAATCAGCCCAAAGGAGGGACGCCCAGTTTGTTGGCTAACCTTCGTTTACTGTTGGTGGAAAGCCTAGT
TCGAGAAGAGGCGGTGCTGCAACATAACCCCAAGTATGCGGCTGAGCTTAAGCAATTTGAGACTAAGCTG
AATGCCATTTTGCAAGAGATGAATGATGCTCTGGAACTCAAACCCGGTAATGTGAGCCCGAAAAACCATC
AAATTGCGACCGCGCAATCCGCACAACGTAAGCTAGGGCAATTACTCAGTAGTGAGCTGCCGATGATGCT
GACGCTCAAAAACCAAGCTGCGATGAACACTTTTCAGCAGTCGGTAAATGAGAAACTGAGCGCGCTATCG
AAAAACGTCAAAACCAGTAGCGCGTCGGTGAGTCAGAAACTGGGTGGATTAGGGGGCTTGCTGTTTGCGT
TGAACCTATGGAATACCATGACGGTTTTGGAGAATATCCGCTATAAGGTCGCACAATACCCCAGTTGGAA
TCCTTTTAAGAACCCGGCGTTGGGCGAAGCCATTTATGCCACTGGCAACACTATTGTAGTCGCCGGTGCC
ATTAGTGCTGGGCGAGCTTGGGTGACGATTGCTGAGCAAGGGTTGTTAGATCGTACACTGAAAAACGCCT
TAAATACCACGAAAGTTTTGGGCACAAAAGATGCCCTAAAAACCTTTGCTAAATCGATCGCCTTGGTGGC
TACCGTGGGCATGATTGCCAGCGCATTAGAAACATGGGAAAGCTGGGGTAAGTTTAATGACAGCAGTAAA
ACCGATCTTGAACGCTTCGGTTATTTGTTAAAAGCTGGAGCAACGGGAGCACAGGGAATTATTTTTTATA
TTCAGTTTTTCACACTCTTAGGTAGTGGAATTGGTGGACCCTCCATAGCTGCGATTTCTGCAGGTTGGAT
GCTCGCCGGTTTTGCTGTGATTGGTATTGTCTATTTGATCGGGGTGATTTTGACCAATGTGTTTAAACGC
TCAGAGTTAGAAATTTGGTTATCAAAATCGACGTGGGGGAAAGAGAGTGCTCATTGGCCAGTGGGCAAAG
AATTGACCGAGTTAGAGCACCTTCTCCATCGTCCGAGTCTTCGGTTGAGTCAAGTTACGCAACGTAAAGC
AGCGCAATGGATGGATTCAGGTTCTTTACAATGGCAGTTGGAACTCACGTTACCCGATTATCTTAAGGGG
CAGACGATAGGCTTACAAATCACCCGTTTGCCAGCGCAGCCGGCATATTATCAACCGCAAAGGGAGGCGG
TAACACCAATACTCATCAATGAACAACAGGGCAAATGGAGTATTGAAGATAATCAGCCAGTGTATCGTAT
TACACTGGGTGGCAGTGAGAAGGATACTGTCGGAGTTTGCGTTGCACTGCCCCTGCGTTGGGGCAAGGAG
CTGAGCCTCAAATTCTATGCCAGTGGAACTCGCGCGGGGGAATTGGATTTACAATCTGCAGAGGCGAATG
ATATTGCCACAAGAAATCTCGTTGTAGGAAAAGGTTAA

Reference
(1) Miyata ST et al. (2013). Dual Expression Profile of Type VI Secretion System Immunity Genes Protects Pandemic Vibrio cholerae. PLoS Pathog. 9(12):e1003752. [PudMed:24348240] experimental
(2) Dong TG et al. (2013). Identification of T6SS-dependent effector and immunity proteins by Tn-seq in Vibrio cholerae. Proc Natl Acad Sci U S A . 110(7):2623-8. [PudMed:23362380] experimental
(3) Miyata ST et al. (2011). Vibrio cholerae requires the type VI secretion system virulence factor VasX to kill Dictyostelium discoideum. Infect Immun. 79(7):2941-9. [PudMed:21555399] experimental
 
experimental experimental literature