SecReT6
Effector Protein ID: 15600894
-
SecReT6 ID2
T6SS typeA1
Gene symbol-
Locus tagVCA0123
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]137581..140634 [+]
ProductvgrG protein
Effector typeProtein
Homologous effectorVCA0123
Descriptiontype VI secretion system Vgr family protein; Muramidase
UniProt IDQ9KN42
KEGG IDvch:VCA0123
PDB ID4NOO, 4NSO
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.30E-60, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 7.40E-25, Aligned region: 374..467
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 536..549
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 731..773
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 787..799
DUF2345 [PF10106], Evalue: 5.30E-05, Aligned region: 570..619
PG_binding_3 [PF09374], Evalue: 0.00087, Aligned region: 734..767
PG_binding_3 [PF09374], Evalue: 0.00087, Aligned region: 785..802
Protein Sequence: 1017 a.a.     [Download]
>gi|15600894|ref|NP_232524.1| vgrG protein [Vibrio cholerae O1 biovar El Tor str. N16961]
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTIL
RDGQVVQQINGIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYA
FALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGG
EINLPYVVDLQFKTTAQVSHTELKDYSFKKPAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFS
QIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQEEGGSGATTYS
NQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETHQGQGYNEL
SFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHE
VGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGS
GSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPE
RILKSDLLKPSDELEKLAKRQASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQK
SYQPSHQTHPSYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGN
GDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFREEQHQFIKRTH
YDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNMESMTDKDIIILVQDYKLVNTE
RLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK
-
Nucleotide Sequence: 3054 bp     [Download]
>gi|15600771|ref|NC_002506.1|:137581-140634 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGGCAAGGTTACAGTTTCAATTAAAGGTGGATGGCCTTGAGGATGAATCCCTCGTCGTACGCGGATTTG
AAGGGCAAGAGTCCTTGTCTGATTCTGTATGGCGCTGTGAACCCTGCTATGGTTTTCGCTATCAGGTTGA
TTTAGCCAGTGCGCTAAGCAACCTTACTGCTGAGCAATTTGTCGACCAAACCGCGCATTTAACCATTCTG
CGTGACGGGCAAGTGGTGCAGCAAATTAACGGTATCGTACGCCAATTGAGTAAAGGCGATACTGGGCATC
GGCACACGTTTTATTCTCTTACGTTAGTACCTGCGCTGGAGCGGCTTTCTTTACGCAGTAATAGCCGTAT
TTTCCAGCAGCAAAGCGTGCCGGAAATTATCTCTATTTTACTGCAAGAGATGGGGATTGAAGATTACGCC
TTTGCCCTTAAGCGTGAGTGTGCCCAGCGTGAGTTTTGTGTGCAGTACCGTGAAACGGATTTGCAGTTTT
TACACCGTATCGCCGCCGAAGAAGGCTTGGTATACAGTCACCTACATGAAGCGCAGAAACACACGCTACT
GTTTACCGATAGCTCGGACAGCCAACCGAAGTTAGCCAAGCCAGTACCTTATAATGCGCTGGCGGGTGGC
GAGATCAATCTCCCTTATGTGGTCGATCTGCAATTCAAGACCACCGCACAAGTCAGCCATACCGAGCTAA
AGGATTACAGCTTTAAAAAGCCAGCTTACGGATTTACTCAGCGCACGCAGGGTAAAGATATCGCTTATCA
GCAGCCAAATTATGAGCATTTTGATGCTCCGGGACGCTACAAAGACGATGCAAATGGCAAGGCCTTTAGC
CAAATTCGCTTAGAGTATTTACGTCGCGATGCTTTGCTTGCTGATGCGAAGAGTGACGAACCTTTGCTGT
TGGCGGGAGTGCGTTTTGACTTGCAAGATCACCTTGATCACGCAATGAATCGAGATTGGCTCGTGGTACA
AGCCAATCACCAAGGGACGCAGCCACAAGCGTTACAAGAAGAGGGTGGTTCAGGCGCTACCACTTACAGC
AATCAGCTAAAACTTATTCCCGCTCACATCACTTGGCGAGCAAGGCCTTGTGCTAAGCCGCAAGTGGATG
GTCCCATGATCGCCACCGTGGTTGGGCCACAAGGTGAAGAGATTTATTGCGATAACTTTGGTCGCGTGAA
AGTGCATTTCCCGTGGGATCGCTACTCAAGTAGCAACGAAAAAAGCTCTTGCTGGGTGCGAGTGGCACAA
GAATGGGCTGGTAGCCAATACGGTAGTATGGCGATTCCGCGAGTTGGCCATGAAGTGATTGTTTCGTTCC
TGAATGGCGATCCGGATCAACCCATCATCACAGGTCGTACGTATCATGCGACCAATACCGCGCCTTACGC
CTTGCCTGACCACAAAACCAAAACCGTGCTGCGCACTGAGACTCACCAAGGGCAAGGCTACAACGAACTG
AGTTTTGAGGATCAAGCGGGCAGCGAACAGATTTTGCTGCATGCACAAAAAGATTGGGATGCGTTGATTG
AGCATGATCACACCGAAGTGATTCGCCACGATCAACATCTCACTGTGGACAATGATCGCTTTACCCGCAT
TCAGCGCAACCAACATTTAACGGTTGAAGGTGAAGTCCGTAGCAAAATCGCACTCGATAGCAGCCATGAA
GTCGGCGCGTCACTACAACACAAAGTCGGGCAGCGCATTGCTGTCGAGGCGGGTAAAGAGATTTCACTCA
AAAGCGGCGCAAAAATCGTGGTTGAAGCCGGAGCGGAGTTAACCCTAAAAGCTGGGGGCAGTTTTGTAAA
AGTCGATGCTGGTGGCGTGCACTTAGTCGGTCCTGCCATTAACCTAAACGCGGGCGGCAGTGCAGGCAGC
GGTAGCGCTTATGGCGGGCAATTAGCGGCAGCACCGAGAATGTTAGCGCAAGCTAAACCAGTAGCAGAAT
TGGTTCAGCCGGATATTGCGGCCTCAATGCAATCAGGCGCGGCGCGTGTTATTGATGTGGCATCACTCCC
CACAATGATGCCGAGTTCAGCCAATAACACGGCAAATGATGAGCCTGTGGCCGAAGAGAAAACACCGGAG
CGAATTTTAAAATCCGATCTCCTCAAACCATCCGATGAGTTAGAGAAACTCGCCAAGCGACAAGCGAGTG
CTTATCGTCAAGGTAATCACAGCGATGAGGTTAAGTTACTACAAGAAGCGCTCATAAAATTGGGGTTTGA
TCTCGGGAAAGCAGGAGCTGATGGTGACTTTGGGAGCAAAACTAAAACCGCGATTGAGCAGTTCCAGAAA
AGCTATCAACCAAGCCACCAAACCCACCCGTCTTACAGCATTGGCGCTGTTGACGGTATTGTCGGCAAAG
GTACACTACTGGCACTAGACGAAGCCTTGATGGATGGGTGGGTGTATGAGAATAATATTTATCAAATATG
GCCTCTAGGTAAAACGTCAGAGAAATATGAGTCGGCAGGAAGAGGCCCAGGGGTTATATCAACAGGAAAT
GGAGATTATGGTGGGGCTTCATATGGTTGCTATCAAATGTCATCAAATCTTGGTGTGGTACAAAAATATA
TTCAGTCATCAAAATTCAAAGAATTCTTTAGTGGATTAAATCCCGCTACGAAAGAGTTTAATGTTGTTTG
GCAGGATATAGCTTCAAGATATCCTCAGGAATTCAGAGAAGAACAACACCAATTTATTAAGAGAACTCAT
TATGATATACAAATAGGACATCTTAGAGGGAAAGGACTTTTGTTTGAACATAATCGAGCTGCTGTACATG
ATTTGATCTGGTCTACTTCAGTACAGTTTGGTGGGAGAACTAATTTGATTTTCAATGCATTGAATGGACA
AAATATGGAAAGTATGACTGATAAGGACATCATTATTCTGGTACAAGATTACAAGCTTGTTAATACAGAA
AGGCTTTTTAAGTCTTCGCCATCATGGTGGAGTGATTTAAAAAAACGTGCGGTATCAGAGAAAAAAGCTT
TACTTGAACTAGAAATTGACGGTTTGGAGGTTGATATAAAATGA

Reference
(1) Dong TG et al. (2013). Identification of T6SS-dependent effector and immunity proteins by Tn-seq in Vibrio cholerae. Proc Natl Acad Sci U S A . 110(7):2623-8. [PudMed:23362380] experimental
(2) Brooks TM et al. (2013). Lytic Activity of the Vibrio cholerae Type VI Secretion Toxin VgrG-3 is Inhibited by the Antitoxin TsaB. J Biol Chem. 288(11):7618-25. [PudMed:23341465] experimental
 
experimental experimental literature