SecReT6
Effector Protein ID: 15601051
-
SecReT6 ID2
T6SS typeA1
Gene symbol-
Locus tagVCA0285
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]305200..305871 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVCA0285
DescriptionTseH
UniProt IDQ9KMN9
KEGG IDvch:VCA0285
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 223 a.a.     [Download]
>gi|15601051|ref|NP_232681.1| hypothetical protein VCA0285 [Vibrio cholerae O1 biovar El Tor str. N16961]
MTDTVSSTPVADTTPYEIFLSGNDDFLIPVVFPDYLISVADEQSFELWGVKIKTPAVKAPYLGHAGVILI
NGETGVTRYYEYGRYKNPKSDIPGNVRKVGVSNVTIKSGLITESSLLKVLKEVSLRSGQEGRISGVVLRG
KFFSEADSWLRGKMDLNNSPDKIPYDLDSHNCMTFVIDLADAMGLDPAWKPPVVVPSAYIEQFQLSEIDL
DYDYKTNKLTVSE
-
Nucleotide Sequence: 672 bp     [Download]
>gi|15600771|ref|NC_002506.1|:305200-305871 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGACTGACACTGTATCATCAACTCCAGTAGCCGATACAACTCCATATGAGATATTTCTTTCAGGTAATG
ACGATTTTTTGATACCTGTAGTATTTCCTGACTACCTAATCTCAGTCGCAGATGAACAATCTTTTGAGTT
ATGGGGTGTAAAAATAAAAACTCCTGCAGTGAAGGCCCCCTACCTTGGTCACGCTGGAGTTATTTTGATT
AATGGTGAAACAGGTGTTACTCGCTATTATGAGTATGGCCGTTACAAGAACCCTAAATCGGATATCCCAG
GAAATGTGAGGAAGGTTGGGGTATCAAATGTAACTATAAAAAGTGGTCTAATTACTGAAAGCTCGTTACT
GAAGGTTCTTAAAGAAGTGTCCCTACGTTCTGGACAGGAGGGGAGAATTTCGGGAGTGGTATTAAGAGGA
AAGTTTTTCTCTGAAGCAGATTCATGGTTAAGGGGAAAAATGGATCTTAATAATAGCCCTGATAAGATAC
CTTATGACTTGGATAGCCATAACTGCATGACATTTGTCATAGATTTAGCTGATGCAATGGGGTTAGACCC
GGCTTGGAAACCTCCTGTTGTTGTACCAAGCGCGTATATTGAACAGTTTCAGTTAAGTGAAATTGATTTA
GATTATGACTATAAGACCAACAAATTAACGGTATCTGAGTGA