SecReT6
Effector Protein ID: 15641426
-
SecReT6 ID2
T6SS typeA1
Gene symbol-
Locus tagVC1415
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002505] [Browse all T6SS(s) in this replicon]
Location [Strand]1509632..1510150 [+]
Producthcp protein
Effector typeProtein
Homologous effectorVC1415
DescriptionHcp protein
UniProt IDH9L4Q3
KEGG IDvch:VC1415, vch:VCA0017
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.30E-38, Aligned region: 6..155
Protein Sequence: 172 a.a.     [Download]
>gi|15641426|ref|NP_231058.1| hcp protein [Vibrio cholerae O1 biovar El Tor str. N16961]
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASIVDIHCEMPHCQDPAKSDFTQ
NVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|15640032|ref|NC_002505.1|:1509632-1510150 Vibrio cholerae O1 biovar El Tor str. N16961 chromosome chromosome I, complete sequence
ATGCCAACTCCATGTTATATCTCTATCGAAGGCCAAACTCAGGGTCTTATCACTGCAGGTGCATGTACTG
CTGACTCTATCGGCGATTCATTCGTTGAAGGCCACGAAGATGAGATGCTGGTTCAGCAGTTTGACCACGT
TGTGACTGTACCGACTGACCCACAATCTGGTCAGCCTTCAGGCCAACGTGTGCACAAGCCATTCAAATTC
ACTGTGGCGCTGAACAAAGCGGTTCCTCTGCTGTACAACGCGCTCTCTTCTGGTGAGAAGCTGAAAACCG
TTGAGCTGAAGTGGTACCGTACCTCTATCGAAGGTAAACAAGAGAACTTCTTCACCACTAAGCTGGAAAA
CGCGTCTATCGTCGACATCCACTGTGAAATGCCACACTGCCAAGACCCAGCAAAATCTGACTTTACTCAG
AATGTGACTGTGTCTCTGTCTTACCGCAAAATCACTTGGGACCACGTTAACGCGGGCACCTCAGGCTCTG
ATGACTGGCGTAAGCCAATCGAAGCGTAA

Reference
(1) Pukatzki S et al. (2006). Identification of a conserved bacterial protein secretion system in Vibrio cholerae using the Dictyostelium host model system. Proc Natl Acad Sci U S A. 103(5):1528-33. [PudMed:16432199] experimental
 
experimental experimental literature