SecReT6
Effector Protein ID: 15641427
-
SecReT6 ID2
T6SS typeA1
Gene symbol-
Locus tagVC1416
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002505] [Browse all T6SS(s) in this replicon]
Location [Strand]1510278..1513769 [+]
ProductvgrG protein
Effector typeProtein
Homologous effectorVC1416
Descriptiontype VI secretion system Vgr family protein; evolved VgrG with C-terminal actin crosslinking domain (ACD)
UniProt IDQ9KS45
KEGG IDvch:VC1416
PDB ID4GQK
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-64, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 6.90E-24, Aligned region: 208..226
Phage_base_V [PF04717], Evalue: 6.90E-24, Aligned region: 374..467
Protein Sequence: 1163 a.a.     [Download]
>gi|15641427|ref|NP_231059.1| vgrG protein [Vibrio cholerae O1 biovar El Tor str. N16961]
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQMVDKRAELKLY
RNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQKQTVPEILSILLQEMGINDYA
FALKRDGVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHEAGKHTLYFSDASDSLSKLPEPIPYNALVGG
AIDTPYIHGLTYRTQAEVSEVQLKDYSFKKPAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFS
QIRLDYLRRHAHTATGQSNEPLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEDGGSGATTYS
NQFSLIPGHLHWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVEFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTETHQGEGFNEL
SFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDHHLTVENDQFTQIKHNQHLTVEWESREAVTGEQVLS
IEGSLHVKTGKVWVNEAGTEIHVKAGQKVVIEAGSEITVKAGGSFVKVDPAGVHLSGALVNLNSGGSAGS
GSGFGGAMPALPGGLEPAVALAPPQTISYQALLQAEQANVPAVKVCPLAAQEATPAVNSITPPPPPPIAP
PMAPPQPIMNPQPTANAQPNLGRSTKATPDFPTHFPKSSIGIENELAGLVVAMPANSAQKFGYVKSAQGD
ALFMLTKDMNQGSYQRPPSLQDGKNYQNWQTHTVELVSYPCEMDDKAAVETRKQAMLWLATHFTTHIDQS
NHQPLAPIQSEDGRFVIEITNAKHVIAAGNGISAESQGQTITMTPSGQQATVGVAAKGFGTSATPELRLL
ESAPWYQKSLKSQFASLTSAENLDDKELAANVFAYLTSIYLKTAELAKKFGIYINEWDPMSEQITPNANG
LTDPKVKNAWEILPRTKPSKIVEILSKSDAKAVMKHIKPQLQSRYSESLSKNVFQYFQDGGEVAGHGINN
ATVGDKHSPELAILFEFRTVPNELQSYLPKTESTTKSEVKLLDQFDPMKRKTVIQQVESLVQNSGDAFDK
WYQSYRDSMNQPPVKNAKKIASANQKAQWVKEHNPQEWQRIIA
-
Nucleotide Sequence: 3492 bp     [Download]
>gi|15640032|ref|NC_002505.1|:1510278-1513769 Vibrio cholerae O1 biovar El Tor str. N16961 chromosome chromosome I, complete sequence
ATGGCGACATTAGCGTACAGCATTGAGGTGGAAGGGCTGGAAGATGAGACTCTGGTGGTCAGAGGCTTCC
ACGGGCAGGAGTCACTCTCTAATAGTGTTTTTTTAGGGCAAGCCTGTTACGGGTTTCGCTACGAAGTGCA
ACTGGCGAGTCGGGTATCAAACCTCACCGCCGAGCAGATGGTGGATAAGCGTGCCGAGCTCAAGCTTTAC
CGCAACTCACAGTTGGTGCAGCGCGTGCACGGCATTGTGCGTGCTTTCAGCCAAGGCGATATCGGCCATC
ACCACACCTTCTACCAACTCACTTTAGTCCCTGCCTTAGAGCGCTTATCCCTGCGTCATAACAGCCGCAT
TTTCCAAAAGCAGACTGTCCCTGAGATTCTCTCTATCTTGCTGCAAGAGATGGGCATCAACGATTACGCT
TTTGCGCTCAAACGTGATGGCGTGCAGCGTGAGTTTTGTGTGCAGTACCGCGAAAGCGATATCGACTTTC
TGCACCGCCTCGCCGCTGAAGAAGGTTTGGTGTACAGCTTTGTCCATGAAGCGGGCAAACATACCCTCTA
TTTCAGTGATGCCAGTGATAGCCTAAGCAAACTGCCGGAGCCTATCCCATACAACGCTTTAGTCGGTGGC
GCGATAGATACCCCGTATATCCACGGCTTAACCTATCGCACCCAAGCAGAAGTGAGCGAAGTTCAGCTCA
AAGACTACAGCTTCAAAAAGCCAGCCTACTCCTTTTTGCAAACCGTGCAGGGTACTGAGCTGGATTATCA
GCAAACGCGCTACCAACATTTTGATGCGCCGGGGCGCTACAAAGACGATGTGAACGGCGCCGCCTTTAGC
CAAATCCGTTTAGACTACCTGCGCCGCCATGCCCATACCGCAACAGGGCAGAGCAACGAGCCGCTGCTGC
GTGCCGGCTATAAGTTTGACCTGCAAGAGCACCTTGACCCCGCGATGAACCGCGATTGGGTGGTAGTGTC
GATTAACCACCAAGGTGAGCAGCCGCAAGCGCTACAAGAAGACGGTGGCAGCGGCGCTACTACTTACAGC
AATCAGTTCAGCTTAATTCCGGGGCATCTTCACTGGCGCGCCGAGCCACAACCCAAACCGCAAGTCGATG
GTCCAATGATTGCCACGGTCGTCGGTCCTGAAGGCGAAGAAATCTTCTGTGATGAACATGGGCGGGTGAA
AATCCATTTCCCGTGGGACCGTTACTCGAACGGTAACGAGCAAAGCTCCTGTTGGGTACGGGTGTCGCAA
GGTTGGGCGGGCAGTCAGTATGGCTTTATCGCTATTCCGCGCATCGGCCATGAAGTGATTGTAGAGTTTT
TAAACGGTGACCCAGACCAACCGATTATCACTGGCCGCACTTATCATGCGACCAACACGCCGCCATACAC
CTTGCCTGAGCACAAAACCAAAACCGTGCTGCGCACCGAGACGCACCAAGGGGAGGGCTTTAACGAGCTC
AGTTTTGAAGACCAAGCGGGCAAAGAGCAAATCTACCTGCATGCGCAGAAAGATTTTGATGGTTTGATTG
AAAACGACCACACCACGGTCATTCGTCACGACCATCACCTGACCGTTGAAAACGACCAATTTACCCAGAT
TAAGCACAACCAACACCTGACGGTGGAGTGGGAAAGTCGAGAAGCGGTAACGGGCGAGCAAGTGCTGAGT
ATTGAAGGCTCGCTGCATGTGAAAACAGGCAAAGTTTGGGTCAATGAAGCGGGTACAGAGATCCATGTAA
AAGCGGGACAGAAAGTGGTGATTGAAGCGGGCTCCGAGATTACCGTTAAAGCGGGCGGCAGCTTTGTGAA
AGTCGATCCGGCTGGGGTGCATCTGTCCGGTGCTTTGGTCAATCTCAACTCTGGCGGCAGCGCTGGTAGT
GGTAGCGGCTTTGGCGGTGCAATGCCCGCCTTACCGGGCGGCTTAGAACCCGCCGTGGCACTGGCTCCAC
CGCAAACCATCTCTTACCAAGCGTTGCTACAGGCCGAGCAAGCGAATGTTCCTGCGGTGAAGGTGTGTCC
TTTAGCCGCTCAAGAAGCAACGCCTGCGGTGAATAGTATCACGCCGCCTCCACCACCACCGATTGCTCCG
CCAATGGCCCCACCACAACCAATAATGAATCCACAGCCAACCGCTAACGCGCAGCCTAATCTTGGAAGAT
CCACTAAGGCAACGCCGGATTTTCCAACACATTTCCCGAAGTCATCCATTGGCATTGAGAATGAGTTAGC
TGGTCTAGTGGTGGCTATGCCAGCCAACTCGGCACAGAAATTTGGCTACGTGAAAAGTGCACAAGGTGAT
GCGCTGTTTATGTTAACGAAAGACATGAACCAAGGTTCGTATCAGCGGCCACCTTCATTACAAGATGGAA
AAAATTATCAGAATTGGCAGACGCATACAGTAGAGTTGGTGAGCTACCCTTGTGAAATGGACGATAAAGC
TGCCGTTGAAACACGCAAACAAGCCATGTTGTGGTTAGCAACCCACTTTACTACGCATATCGACCAGTCC
AATCATCAACCATTAGCTCCTATTCAAAGTGAAGACGGACGCTTTGTTATCGAAATCACTAATGCGAAGC
ATGTGATTGCTGCGGGCAATGGGATTTCTGCAGAATCTCAAGGTCAAACAATCACGATGACACCAAGTGG
ACAACAAGCCACAGTGGGTGTTGCTGCTAAAGGTTTCGGGACGAGTGCAACGCCAGAATTAAGGTTACTT
GAATCGGCACCTTGGTATCAGAAATCACTCAAGAGCCAATTTGCATCTCTAACGAGCGCAGAAAACTTGG
ATGATAAAGAGTTAGCTGCAAACGTATTTGCTTATCTGACGTCTATTTATTTAAAAACAGCAGAGCTAGC
GAAGAAGTTTGGTATTTACATCAATGAATGGGACCCCATGTCGGAGCAAATTACTCCAAATGCGAATGGA
TTAACGGATCCAAAAGTAAAAAATGCATGGGAAATATTGCCACGTACAAAACCAAGCAAAATAGTAGAAA
TACTCAGTAAGAGTGATGCCAAAGCGGTTATGAAACATATCAAGCCTCAATTGCAGTCTCGCTATTCTGA
GAGTTTGTCGAAAAATGTATTTCAATATTTCCAAGATGGTGGTGAAGTAGCCGGACACGGTATTAATAAT
GCGACGGTCGGTGATAAACATAGTCCGGAATTGGCGATTTTGTTTGAGTTCAGAACTGTTCCGAATGAAC
TGCAAAGTTATTTGCCTAAAACAGAATCGACAACTAAGTCAGAAGTGAAGTTACTCGATCAGTTTGATCC
TATGAAGCGTAAAACAGTAATTCAACAAGTAGAATCGCTTGTGCAAAATAGTGGCGATGCATTTGATAAA
TGGTACCAAAGCTACCGAGACTCCATGAATCAACCTCCCGTTAAAAATGCGAAGAAAATTGCTTCCGCGA
ATCAAAAAGCACAATGGGTTAAAGAGCATAATCCTCAAGAATGGCAACGCATTATTGCTTAG

Reference
(1) Miyata ST et al. (2011). Vibrio cholerae requires the type VI secretion system virulence factor VasX to kill Dictyostelium discoideum. Infect Immun. 79(7):2941-9. [PudMed:21555399] experimental
(2) Pukatzki S et al. (2007). Type VI secretion system translocates a phage tail spike-like protein into target cells where it cross-links actin. Proc Natl Acad Sci U S A. 104(39):15508-13. [PudMed:17873062] experimental
 
experimental experimental literature