SecReT6
Effector Protein ID: 156501495
-
SecReT6 ID474
T6SS typeB
Gene symbol-
Locus tagFTA_0126
StrainFrancisella tularensis subsp. holarctica FTNF002-00
Repliconchromosome [GenBank: NC_009749] [Browse all T6SS(s) in this replicon]
Location [Strand]111904..113055 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorFTL_0118
DescriptionIglI protein
UniProt IDA7N9F1
KEGG IDfta:FTA_0126
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 383 a.a.     [Download]
>gi|156501495|ref|YP_001427560.1| hypothetical protein FTA_0126 [Francisella tularensis subsp. holarctica FTNF002-00]
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFLSLNSEICLNL
DTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDANFAQMQNQDKLLPNNIDSIIE
IVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQKNDTYSDKESINQVEATITDQKTIQGSEKW
KTLIEKIEVLKALVESERMFETSIVYNDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSS
IQWSIAQKMYNIDYKSFLDTLEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIV
IKQRTNNKKNQNDPVEKISNKIDEDYFEDLFDI
-
Nucleotide Sequence: 1152 bp     [Download]
>gi|156501369|ref|NC_009749.1|:c113055-111904 Francisella tularensis subsp. holarctica FTNF002-00 chromosome, complete genome
ATGAGTCAGATAATATCTACACTAAATAATATTGATTTAGTAACTCAAGATAAAGTAAATCTGATTAGTA
ATATGCAAATACAAGCAAAATATGAAAACGCTGAGTATAAGTCATTTATTGATCAATTAATAGATAATCT
TAATACTACTAGAAGCATAGATATATATAACTTATTTCTATCTTTAAATTCAGAAATATGCCTCAATTTA
GATACGGTTGATAATATCTCTAAAATTATTAGCTCTTATTTATCTATTCTAAATACTAATTTCACAAGAA
TTAGTCCATCAGAATCAAAGCAAAAAAACCAGCTAGCTGAAAAAGGAATAAACAAATTCTTAGTCACTAT
GGATGCAAATTTTGCGCAAATGCAGAATCAAGACAAGTTGTTACCAAATAACATAGATTCTATTATAGAA
ATTGTACAGGAAGTAATAATATTTTTTGAGAAAAATAACTTAAATTATAATTCTGATTTTAAAATCCAAC
TAAATAAGACTCTCAGAAAAATAAAAAGTTCTTTGATTTTAAAAGATCAAAAAAATGATACGTATTCCGA
TAAAGAATCAATAAATCAAGTTGAAGCAACTATCACAGATCAAAAAACCATACAAGGCTCTGAGAAATGG
AAAACTCTTATTGAAAAAATTGAAGTTTTAAAAGCTCTAGTTGAAAGTGAAAGAATGTTTGAAACATCTA
TTGTTTATAATGATATACAAAACTTATTAGTTAACTTCGATCCTAAAGAGTATTTTCCAGAAATTTTCTT
TCCATTATACAAGAAGATAGCTCCTTTTATTGGCAATATCCATAAAAACATAGACTACTACTCATCAAGT
ATTCAGTGGAGTATAGCTCAGAAGATGTACAACATAGATTATAAGAGTTTTCTAGATACTCTTGAGAAAA
TGCCCGAAAATAATTTTTTAAATTCTTCTTCTGATATAACTAAAAATTTCTTTTATGAAACATCCTCAGA
GGTGGAAAAAACTCCTATCGAAGAACATAAAATAATTGCAGATACAGATGCTATCAAAGAAGAAATAGTA
ATAAAACAGCGAACCAATAATAAAAAAAACCAGAATGACCCCGTAGAAAAAATTTCAAATAAAATAGATG
AAGACTATTTTGAAGATCTTTTTGACATATAA