SecReT6
Effector Protein ID: 156936615
-
SecReT6 ID228
T6SS typeA2
Gene symbol-
Locus tagESA_pESA3p05496
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA3 [GenBank: NC_009780] [Browse all T6SS(s) in this replicon]
Location [Strand]59110..59601 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDA7MRF5
KEGG IDesa:ESA_pESA3p05496
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.70E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|156936615|ref|YP_001440529.1| hypothetical protein ESA_pESA3p05496 [Cronobacter sakazakii ATCC BAA-894]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHSLYIPTDNNTGKLTGTRIHTPFLFTKEIDASSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKLVKVAPLMHDIKEPSKEKHNHLERIELRYE
KITWTYKDGNIIHSDSWNERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|156936546|ref|NC_009780.1|:59110-59601 Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence
ATGGCAATTCCTGTTTATCTCTGGCTGAAGGACGACGGTGGCGCGGACATCAAGGGTTCCGTTGATGTGA
AGGACCGCGAGGGCAGCATTGAGGTGGTGGCGCAGGAGCACTCGCTGTACATCCCGACCGACAACAACAC
CGGCAAGCTGACCGGCACCCGTATCCACACGCCGTTCCTGTTCACCAAGGAAATCGACGCCTCCAGCCCG
TATCTGTACAAGGCGGTGACCACCGGCCAGACCCTGAAGTCCGCCGAGTTTAAATGGTACCGCATCAACG
ACGCGGGCCAGGAGGTGGAGTATTTCAACACGAAGCTTGAGAACGTGAAGCTGGTGAAAGTGGCGCCGCT
GATGCACGACATCAAGGAGCCTTCCAAGGAGAAGCACAACCATCTTGAGCGCATTGAGCTGCGCTACGAA
AAAATCACCTGGACCTACAAGGACGGCAACATCATCCATTCCGATTCGTGGAACGAACGTACCACTGCCT
GA