SecReT6
Effector Protein ID: 156972866
-
SecReT6 ID229
T6SS typeA1
Gene symbol-
Locus tagVIBHAR_00543
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009783] [Browse all T6SS(s) in this replicon]
Location [Strand]522122..524701 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVPA1263
DescriptionVPA1263
UniProt IDA7MTX8
KEGG IDvca:M892_10090 vha:VIBHAR_00543
PDB IDNA
Domain hit(s) vs Pfam Colicin-DNase [PF12639], Evalue: 1.00E-32, Aligned region: 727..857
Pyocin_S [PF06958], Evalue: 1.10E-30, Aligned region: 590..723
LysM [PF01476], Evalue: 3.30E-05, Aligned region: 359..403
Protein Sequence: 859 a.a.     [Download]
>gi|156972866|ref|YP_001443773.1| hypothetical protein VIBHAR_00543 [Vibrio harveyi ATCC BAA-1116]
MSHEFGLIEGNFHNLSEADVVSAIPAHLTFEQLKQHLHEGKLVLVSDTPQIPALLSYNDPIGPKTWRLNS
EVISAFSDDATKELLAKTKIPRVTGGYSTRIVETATLERAYTPQPIATESEEEITKEFEYSFEVGCSDAT
IKKMVHSDFALAKTEKENAVTRWEQTKTEQGTRYTALCVFDEPKRLNIHIADDNLGLTPLEAITLQKAGS
HKTEEGFIPVVPAVRLGERLGLPTEGYYYHLNDGELVQEYKILGQEKWAFYATRSTQDKLNDERGFTKDQ
SAILVYWKLANQVLENQYIIYLERQITREELDNLSEDWLSENGIKLDIPALFDVAKQPEEARVEDNNDET
EAEQTAATHIVVAGETWQSIAERYGMGAKALLSLNPVFEADPLSLTIGDEIVVAEAQQKQTPDKKNTFPP
LRPQTYNNIRNSHYQHSDPLLGLTKYRAINAADFVEGDVAILNLKDATSSLVFAKSCTRPEGCIEIGDQQ
ESISNFGPWSFFFAQANATPAAVIPAIQATQAQMAMGSSAAVAGSPEQTQQTQTAAMQLDKLAGTLKDKI
VEGYRWQVEGIGALFAMQQNLFGDNTQYTDQDLRQVTTAQSRVRVHITEPQDGEFYPHVQGYHVDDTRIP
IKYVKQGNNGQLSVAIEDNGPTIYWTPEENGEASWQTTPDHSDDFEKEDILVTPIHSDGDANVTVTPAPE
EKDWRDAILVFPESSGIAPLYVVYKESPRDKPGVVTGKGEDIFGIWLAGAGKDLGAPIPSQIADKLRGKE
FSSFDAFRKAFWLEVSKDSDLKGQFNAQNQIRIGLGKAPKARSRDKVGKRKSFELHHVDEVQNGGKVYDL
DNLKVTTPKNHIDIHRGMK
-
Nucleotide Sequence: 2580 bp     [Download]
>gi|156972381|ref|NC_009783.1|:c524701-522122 Vibrio harveyi ATCC BAA-1116 chromosome I, complete sequence
ATGTCCCATGAATTCGGGTTGATAGAGGGCAACTTCCACAACCTTTCGGAAGCAGATGTCGTCTCTGCTA
TTCCTGCTCATCTTACCTTTGAGCAGCTAAAACAACACCTCCACGAGGGTAAGCTCGTACTTGTGAGTGA
TACACCTCAAATTCCCGCACTTCTGAGTTACAACGACCCAATTGGTCCTAAAACATGGCGCCTAAACTCT
GAGGTTATCTCTGCATTTTCGGATGATGCGACTAAGGAGTTGTTAGCAAAGACTAAAATCCCCAGAGTAA
CGGGAGGGTACAGCACACGTATTGTAGAGACCGCGACACTCGAACGAGCTTACACGCCGCAGCCAATAGC
AACCGAAAGTGAAGAGGAAATCACCAAGGAATTCGAGTACAGCTTCGAAGTTGGCTGCTCGGATGCCACC
ATAAAGAAAATGGTGCACAGTGACTTTGCTTTAGCGAAAACTGAAAAAGAGAACGCGGTGACTCGCTGGG
AACAAACCAAAACCGAGCAAGGCACCCGCTACACAGCGTTATGTGTGTTTGATGAGCCAAAGCGTTTAAA
TATCCATATTGCTGATGACAACCTCGGGCTGACACCACTTGAAGCCATCACACTACAAAAAGCTGGCAGC
CATAAAACTGAGGAAGGTTTTATACCTGTTGTTCCGGCTGTGCGATTGGGCGAACGCCTAGGCTTGCCGA
CAGAAGGCTATTACTACCACTTAAATGATGGTGAACTGGTCCAAGAGTACAAAATTCTCGGACAAGAAAA
ATGGGCGTTTTACGCTACGCGATCGACACAAGACAAGCTCAATGATGAGCGTGGTTTTACCAAAGACCAA
AGCGCTATATTGGTGTATTGGAAGTTGGCCAACCAAGTCCTTGAGAACCAATACATCATTTATCTTGAGC
GCCAAATCACACGAGAAGAGCTCGATAACCTCAGTGAAGATTGGCTGAGTGAAAACGGGATAAAGTTGGA
TATTCCTGCACTGTTTGATGTAGCTAAACAGCCGGAAGAAGCACGCGTAGAAGATAACAACGATGAGACG
GAAGCAGAACAAACCGCAGCAACGCACATCGTAGTTGCAGGGGAAACCTGGCAGAGCATCGCTGAACGGT
ATGGTATGGGAGCGAAAGCCTTGCTCTCGCTTAACCCAGTGTTTGAGGCCGACCCTCTATCACTCACAAT
TGGTGATGAAATTGTTGTTGCAGAAGCACAGCAAAAACAAACACCGGACAAAAAGAACACTTTTCCGCCT
CTGCGCCCGCAAACCTACAACAACATCCGCAACAGTCATTACCAACACAGCGATCCATTGCTTGGGTTGA
CCAAATACCGAGCCATCAACGCCGCTGATTTCGTCGAAGGTGATGTCGCCATCCTTAACTTAAAAGACGC
CACAAGCTCGCTCGTGTTCGCTAAATCCTGCACCAGGCCAGAAGGGTGTATTGAAATTGGTGACCAACAA
GAGTCAATCAGTAACTTCGGGCCTTGGTCATTCTTTTTTGCACAAGCGAATGCGACCCCAGCAGCTGTCA
TACCCGCCATTCAAGCAACACAAGCACAAATGGCCATGGGAAGTTCCGCAGCTGTCGCCGGCTCACCAGA
GCAAACGCAGCAAACCCAAACTGCGGCGATGCAGTTGGATAAACTGGCAGGAACATTGAAAGACAAAATC
GTTGAGGGCTACCGCTGGCAAGTAGAAGGCATTGGCGCCTTGTTTGCCATGCAGCAAAACTTATTTGGCG
ATAACACCCAATACACAGACCAAGATTTGCGCCAAGTGACCACGGCGCAAAGCCGCGTTCGTGTCCACAT
TACCGAGCCCCAAGATGGAGAGTTTTACCCGCACGTGCAGGGCTATCATGTAGACGACACGCGTATCCCC
ATCAAATACGTGAAACAGGGAAATAATGGCCAACTGTCCGTTGCGATTGAAGATAACGGACCAACCATCT
ATTGGACACCAGAAGAAAACGGTGAAGCAAGTTGGCAAACTACTCCCGATCATAGTGATGACTTTGAAAA
AGAAGATATACTCGTCACGCCAATCCACTCGGATGGCGATGCGAACGTCACCGTTACGCCTGCGCCGGAA
GAGAAAGACTGGCGTGATGCGATCTTGGTATTCCCGGAAAGCTCAGGTATTGCACCGCTCTATGTGGTTT
ACAAAGAAAGCCCGAGGGATAAGCCCGGAGTCGTTACCGGGAAAGGCGAAGATATCTTTGGCATTTGGTT
GGCAGGTGCAGGTAAGGACTTAGGAGCCCCAATACCGTCTCAAATTGCAGATAAGCTGAGAGGAAAAGAA
TTCAGCAGCTTTGATGCGTTTCGAAAAGCATTCTGGTTAGAGGTATCTAAAGACAGCGATTTAAAGGGAC
AATTTAATGCACAAAACCAAATTCGAATCGGGTTAGGGAAGGCTCCTAAAGCAAGAAGTCGAGATAAAGT
AGGAAAGAGAAAATCTTTTGAGCTACATCATGTAGATGAAGTGCAGAATGGTGGCAAGGTTTACGATTTA
GATAATTTAAAAGTGACCACACCCAAAAATCATATTGATATTCATAGAGGTATGAAGTGA