SecReT6
Effector Protein ID: 156977092
-
SecReT6 ID229
T6SS typeA1
Gene symbol-
Locus tagVIBHAR_05877
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1072915..1074612 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorVP1388
DescriptionVP1388
UniProt IDA7N4P2
KEGG IDvha:VIBHAR_05877
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 565 a.a.     [Download]
>gi|156977092|ref|YP_001447998.1| hypothetical protein VIBHAR_05877 [Vibrio harveyi ATCC BAA-1116]
MHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRVRNSENILRNLPKELAQKISISAKKSSAGLLTAIRNE
LGNGNWVALSSFSRRTPLTDAQLQSFPRLKAQLESVSSTGESKVYKAGYKQVTDDVTLVRSYAHVPYEPS
PEHKIVVEFAGQWSSNAACLMLGKTDAQKEKVTVSKADTENKHRSLATFKDLDAEGKTLYIKIPCSDQPQ
PILLKLAEDLQPVDKETQMDEWDNVLVPVRPLAYLDGSNDKAKASDLRGGFLYVFWKGKLWREMAINEKG
YYQDVDVEYYRTLEQEEKKKDTPQVIQRSASGFAMAHFWAPYKISGEVQQGENGLKFIFSPKQKRFAQIE
ALESDAALLEKSSTPLDELSSYSDAQSFSSQEFTSDVDSAAIHKVTEDDMPWLSDQQAIVRSYDQSNTVI
AYVDGKNSGFLVRLEVGLADGPLAEQLDPYSLASYDGLVAIMEDSESDWRVTEPFELISKDGYISALVTG
MPPKGKFTLVLSHLGGQDSEVMMFEGLTYQEITAEPPELPMASKHEEQRVPDEVNEERERQKKTLDMMLE
LINAN
-
Nucleotide Sequence: 1698 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1074612-1072915 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGCATTTAGTTTGCAAATTTATACCTAGCTCGAAGCTTTCCTCCAACGAGCTATCCTACGTCCTTACAC
CTGATGAATGTATAGGGCAGCTTTCGCGTGTGCGAAATTCAGAAAATATTCTCAGAAACCTGCCTAAAGA
GCTTGCTCAGAAGATCTCAATCTCTGCCAAAAAGTCTAGCGCCGGCTTGCTAACGGCTATTCGAAATGAG
CTAGGAAATGGTAACTGGGTGGCGTTGTCTTCCTTCTCTCGTAGAACGCCGTTAACGGATGCTCAATTAC
AAAGTTTCCCAAGACTAAAAGCACAGCTTGAATCTGTCTCATCGACTGGTGAGAGTAAAGTTTATAAAGC
AGGTTATAAGCAGGTAACGGACGATGTGACATTGGTTCGCAGTTACGCGCATGTGCCTTATGAACCAAGT
CCAGAACATAAAATCGTTGTCGAGTTTGCTGGGCAGTGGTCTAGCAATGCAGCCTGTTTGATGTTGGGAA
AAACCGACGCACAAAAAGAAAAAGTGACTGTAAGTAAGGCTGATACCGAGAACAAACACCGCAGCCTTGC
CACGTTTAAAGATCTGGATGCTGAAGGCAAAACGCTTTATATCAAAATCCCTTGTTCCGACCAGCCTCAG
CCAATCTTGCTTAAACTCGCTGAAGACCTGCAACCAGTCGATAAAGAAACTCAGATGGATGAGTGGGATA
ACGTGTTGGTGCCGGTCAGACCTTTGGCTTACTTAGATGGTAGCAACGACAAAGCAAAAGCTTCTGACCT
GCGTGGTGGTTTCCTTTATGTGTTTTGGAAAGGAAAGCTTTGGCGAGAGATGGCGATAAACGAGAAAGGT
TACTACCAAGATGTTGACGTCGAGTATTACCGCACGCTAGAGCAAGAAGAAAAGAAAAAAGACACACCTC
AGGTAATACAAAGAAGCGCAAGCGGTTTTGCTATGGCGCATTTCTGGGCACCTTACAAAATATCGGGTGA
AGTCCAACAGGGAGAAAATGGACTCAAGTTCATTTTCTCACCAAAGCAAAAGCGCTTTGCTCAAATTGAA
GCATTAGAATCAGATGCTGCTTTGCTTGAGAAATCCAGCACACCATTAGATGAATTAAGCAGTTACAGTG
ACGCACAGTCATTCAGTTCACAAGAATTCACCTCCGATGTAGACAGTGCCGCCATCCACAAAGTTACCGA
AGACGACATGCCATGGCTGAGTGACCAACAAGCCATCGTTCGCAGTTATGACCAGAGTAATACGGTCATT
GCTTATGTGGATGGCAAAAACAGTGGTTTTCTTGTCCGTTTGGAAGTTGGCTTGGCAGATGGCCCATTGG
CAGAACAGCTAGACCCTTACTCGTTGGCTTCGTATGACGGCTTGGTTGCCATTATGGAGGATTCTGAAAG
TGACTGGCGAGTGACCGAGCCCTTTGAGTTAATCAGTAAGGATGGTTATATCAGTGCCTTAGTGACAGGT
ATGCCTCCCAAAGGAAAGTTTACACTTGTGCTTTCGCACCTTGGGGGGCAAGACAGCGAGGTGATGATGT
TTGAAGGGCTGACGTACCAAGAGATCACCGCAGAACCACCAGAATTACCGATGGCTTCTAAGCACGAAGA
ACAGCGAGTGCCTGATGAAGTTAATGAAGAAAGAGAGCGTCAAAAGAAGACATTAGACATGATGCTAGAG
CTTATCAACGCCAATTAA