SecReT6
Effector Protein ID: 15801381
-
SecReT6 ID6
T6SS typeA1
Gene symbol-
Locus tagZ1921
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]1744916..1745806 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorZ1921
DescriptionKatN
UniProt IDA0A4Q2THA6
KEGG IDece:Z1921
PDB IDNA
Domain hit(s) vs Pfam Mn_catalase [PF05067], Evalue: 6.6e-89, Aligned region: 1-292
Protein Sequence: 296 a.a.     [Download]
>gi|15801381|ref|NP_287398.1| unnamed protein product [Escherichia coli O157:H7 str. EDL933]
MFRHVKKLQYTVRVSEPNPGLANLLLEQFGGPQGELAAACRYFTQGLSDEDAGRRDMLMDIATEELSHLE
IIGSLVGMLNKGAKGALAEGTENEAELYRSLTQNGNDSHITSLLYGGGPALTNSAGVPWTAAYVDTIGEV
TADLRSNIAAEARAKIIYERLINVTDDPGVKDTLAFLMTREAAHMLSFEKALHSIRNTFPPGKLPPLEKY
KNVYYNMSEGEDVRGSWNSDENFDYVSDPVSAVDGGDGKASINLSTKQEAMIKAMATRLKSHEDINPVTG
AELAEGEPQTKINSKN
-
Nucleotide Sequence: 891 bp     [Download]
>gi|16445223|ref|NC_002655.2|:c1745806-1744916 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
ATGTTTAGACACGTGAAAAAACTTCAATATACAGTACGTGTAAGTGAGCCAAACCCAGGCTTGGCTAATC
TACTCTTAGAACAATTCGGTGGGCCACAGGGTGAGCTTGCAGCAGCATGCCGATACTTCACTCAAGGCTT
AAGTGATGAAGATGCAGGCCGAAGGGATATGCTGATGGACATAGCAACAGAAGAACTAAGTCATCTCGAA
ATTATTGGTTCTCTTGTTGGTATGCTCAACAAAGGTGCAAAAGGAGCACTTGCTGAAGGAACTGAGAATG
AAGCTGAGCTTTACCGTTCCTTAACTCAAAATGGCAATGATAGCCATATAACTTCTCTCCTCTACGGAGG
AGGCCCAGCATTAACTAATTCAGCTGGAGTACCCTGGACTGCAGCTTATGTTGATACTATTGGCGAAGTC
ACGGCCGATCTTCGTTCAAATATTGCAGCTGAAGCTCGGGCAAAGATCATTTACGAACGTCTCATTAATG
TTACTGATGATCCTGGAGTAAAAGACACTCTGGCATTTTTAATGACCCGGGAAGCAGCACACATGCTTTC
ATTTGAAAAAGCATTACATTCAATTCGTAACACCTTTCCACCAGGAAAATTACCACCACTTGAGAAATAC
AAAAACGTATATTACAACATGTCAGAAGGTGAAGACGTCAGAGGTAGTTGGAACAGTGATGAAAACTTTG
ACTATGTTTCCGATCCAGTTTCAGCGGTTGACGGTGGGGATGGGAAGGCCTCGATAAATCTTTCGACCAA
GCAAGAAGCTATGATAAAAGCTATGGCAACAAGGTTGAAATCCCATGAAGACATCAATCCTGTCACTGGC
GCTGAGCTTGCTGAAGGAGAACCACAAACAAAGATAAATAGTAAAAACTAA

Reference
(1) Wan B, Zhang Q, Ni J, Li S, Wen D, Li J, Xiao H, He P, Ou HY, Tao J, Teng Q, Lu J, Wu W, Yao YF (2017). Type VI secretion system contributes to Enterohemorrhagic Escherichia coli virulence by secreting catalase against host reactive oxygen species (ROS). PLoS Pathog. 13(3):e1006246. [PudMed:28288207] experimental
 
experimental experimental literature