SecReT6
Effector Protein ID: 15804134
rhsA
SecReT6 ID6
T6SS typeA1
Gene symbolrhsA
Locus tagZ5014
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]4572113..4576246 [+]
ProductrhsA protein in rhs element
Effector typeProtein
Homologous effectorZ5014
DescriptionRhs-CT5,encodes a C-terminal Toxin-55 domain with putative RNase activity
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.4e-05, Aligned region: 361-396
RHS_repeat [PF05593], Evalue: 1.9e-06, Aligned region: 425-463
RHS_repeat [PF05593], Evalue: 3.7e-05, Aligned region: 489-512
RHS_repeat [PF05593], Evalue: 6.7e-05, Aligned region: 533-570
RHS_repeat [PF05593], Evalue: 4.3e-09, Aligned region: 575-612
RHS_repeat [PF05593], Evalue: 2.4e-08, Aligned region: 637-674
RHS_repeat [PF05593], Evalue: 4.0e-08, Aligned region: 936-985
Ntox34 [PF15606], Evalue: 2.7e-42, Aligned region: 1298-1372
RHS [PF03527], Evalue: 6.6e-14, Aligned region: 1143-1180
Protein Sequence: 1377 a.a.     [Download]
>gi|15804134|ref|NP_290173.1| rhsA gene product [Escherichia coli O157:H7 str. EDL933]
MSGKPAARQGDMTQYGGSIVQGSAGVRIGAPTGVACSVCPGGVTSGHPVNPLLGAKVLPGETDIALPGPL
PFILSRTYSSYRTKTPAPVGSLGPGWKMPADIRLQLRDNTLILSDNGGRSLYFEHLFPGEDGYSRSESLW
LVRGGVAKLDEGHRLAALWQALPEELRLSPHRYLATNSPQGPWWLLGWCERVPEADEVLPAPLPPYRVLT
GLVDRFGRTQTFHREAAGEFSGEITGVTDGAGRHFRLVLTTQAQRAEEARQQAISGGTEPSAFPDTLPGY
TEYGRDNGIRLSAVWLTHDPEYPENLPAAPLVRYGWTPRGELAVVYDRSGKQVRSFTYDDKYRGRMVAHR
HTGRPEIRYRYDSDGRVTEQLNPAGLSYTYQYEKDRITITDSLNRREVLHTQGEGGLKRVVKKEHADGSV
TQSQFDAVGRLRAQTDAAGRTTEYSPDVVTGLITRITTPDGRASAFYYNHHSQLTSATGPDGLEIRREYD
EWGRLIQETAPDGDITRYRYDNPHSDLPCATEDATGSRKTMTWSRYGQLLSFTDCSGYVTRYDHDRFGQM
TAVHREEGLSQYRAYDSRGQLIAVKDTQGHETRYEYNAAGDLTTVIAPDGSRNGTQYDAWGKAICTTQGG
LTRSMEYDAAGRVIRLTSENGSHTTFRYDVLDRLIQETGFDGRTQRYHHDLTGKLIRSEDEGLVTHWHYD
EADRLTHRTVKGETAERWQYDERGWLTDISHISEGHRVTVHYGYDEKGRLTGERQTVHHPQTEALLWQHE
TRHAYNAQGLANRCIPDSLPAVEWLTYGSGWLAGMKLGDTPLVDFTRDRLHRKTLRRFGRYELTTAYTPA
GQLQSQHLNSLQYDRDYTWNDNGELIRISSPRQTRSYSYSDSGRLTGVHTTAANLDIRIPYATDPAGNRL
PDPELHPDSTLSMWPDNRIARDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERTHRYHYDSQHRLVHYTR
TQYEEPLVESRYLYDPLGRRVAKRVWRRERDLTGWMSLSRKPQVTWYGWDGDRLTTIQNDRTRIQTIYQP
GSFTPLIRVETATGELAKTQRRSLADALQQSGGEDGGSVVFPPVLVQMLDRLESEILADRVSEESRRWLA
SCGLTVAQMQSQMDPVYTPARKIHLYHCDHRGLPLALISAEGATEWCAEYDEWGNLLNEENPHQLQQLIR
LPGQQYDEESGLYYNRHRYYDPLHGRYITHDPIGLKGGWNFYQYPLNPVINVIRKLVDVFPRPFPLPIPW
PKSPAQQQADDNAAKALTKWWNDTASQRIFDSLILNNPGLALDITMIASRGNVADTGITDRVNDIINDRF
WSDGKKPDRCDVLQELIDCGDISAKDAKSTQKAWNCRHSRQSNDKKR
-
Nucleotide Sequence: 4134 bp     [Download]
>gi|16445223|ref|NC_002655.2|:4572113-4576246 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
ATGAGCGGAAAACCGGCGGCGCGTCAGGGCGACATGACGCAGTATGGCGGTAGCATTGTTCAGGGTTCAG
CCGGGGTGCGCATTGGTGCCCCCACCGGCGTGGCCTGTTCGGTGTGCCCCGGCGGAGTGACGTCCGGCCA
TCCGGTCAATCCCCTGCTCGGTGCAAAGGTCCTTCCCGGTGAAACCGACATCGCCCTGCCCGGCCCGCTG
CCGTTCATCCTCTCCCGCACCTACAGCAGTTACCGGACAAAAACGCCCGCGCCGGTGGGGAGCCTCGGCC
CCGGCTGGAAAATGCCTGCGGATATCCGCTTACAGCTGCGCGATAACACACTGATACTCAGTGATAACGG
CGGCAGAAGCCTGTATTTTGAGCACCTGTTTCCCGGTGAGGACGGTTACAGCCGCAGCGAGTCACTCTGG
CTGGTGCGCGGCGGCGTGGCGAAACTGGATGAAGGTCACCGGCTGGCCGCACTCTGGCAGGCGCTGCCGG
AAGAACTCCGCTTAAGTCCGCATCGTTATCTGGCGACAAACAGTCCGCAGGGGCCGTGGTGGCTGCTCGG
CTGGTGTGAGCGGGTGCCGGAAGCGGATGAGGTGCTGCCTGCGCCGCTGCCGCCGTACCGGGTACTGACC
GGGCTGGTGGACCGCTTCGGGCGCACACAGACGTTCCACCGCGAAGCCGCCGGTGAATTCAGCGGCGAAA
TCACCGGCGTGACGGATGGTGCCGGGCGTCACTTCCGGCTGGTACTGACCACGCAGGCGCAGCGGGCAGA
AGAAGCCCGGCAGCAGGCCATTTCCGGCGGGACGGAACCGTCCGCTTTTCCTGATACCCTGCCGGGTTAC
ACCGAATATGGCCGGGACAACGGCATCCGTCTGTCTGCCGTGTGGCTGACGCACGACCCGGAATACCCGG
AGAATTTACCTGCCGCGCCGCTGGTGCGCTATGGCTGGACGCCGCGCGGCGAACTGGCGGTGGTGTATGA
CCGTAGTGGCAAACAGGTGCGCAGCTTTACTTACGATGATAAATACCGGGGCCGGATGGTGGCGCACCGT
CACACGGGCCGGCCGGAAATCCGTTACCGTTACGACAGCGACGGGCGGGTGACAGAACAGCTAAACCCGG
CAGGCTTAAGCTACACGTATCAGTATGAGAAAGACCGCATCACCATCACCGACAGCCTGAACCGCCGTGA
AGTCCTGCACACGCAGGGTGAAGGCGGGCTGAAGCGGGTGGTGAAAAAGGAACACGCGGACGGCAGCGTC
ACGCAGAGTCAGTTTGACGCGGTGGGCAGGCTCAGGGCACAGACGGATGCCGCAGGCAGGACAACAGAAT
ACAGCCCGGATGTGGTGACGGGCCTCATCACGCGCATCACCACGCCGGATGGCAGGGCATCGGCGTTTTA
CTATAACCACCACAGCCAGTTAACGTCAGCCACCGGGCCTGACGGGCTGGAAATACGCCGGGAATATGAT
GAATGGGGCCGTCTGATTCAGGAAACTGCCCCTGACGGCGATATCACCCGCTACCGTTATGATAATCCAC
ACAGTGACTTACCCTGCGCAACGGAAGATGCCACCGGCAGCCGGAAAACCATGACGTGGAGCCGTTACGG
TCAGTTGCTGAGCTTCACCGACTGTTCCGGTTATGTAACCCGTTATGACCATGACCGCTTCGGGCAGATG
ACGGCGGTGCACCGCGAGGAAGGGCTGAGTCAGTACCGCGCATACGACAGCCGTGGACAGTTAATTGCCG
TGAAAGACACGCAGGGCCATGAAACGCGGTATGAATACAACGCCGCCGGTGACCTGACCACCGTCATTGC
CCCGGACGGCAGCAGAAACGGGACACAGTACGATGCGTGGGGAAAAGCCATCTGTACCACGCAGGGCGGT
CTGACGCGCAGTATGGAATACGATGCTGCCGGACGGGTCATCCGCCTGACCAGTGAAAACGGCAGCCACA
CCACCTTCCGTTACGATGTACTCGACCGGCTGATACAGGAAACCGGCTTTGACGGCCGCACACAGCGTTA
TCACCACGACCTGACCGGCAAACTTATCCGCAGCGAGGATGAGGGGCTGGTCACCCACTGGCACTATGAC
GAAGCAGACCGCCTCACGCACCGCACCGTGAAGGGTGAAACCGCAGAGCGCTGGCAGTATGACGAACGCG
GCTGGCTGACAGACATCAGCCATATCAGCGAAGGGCACCGGGTGACGGTGCATTACGGGTATGATGAGAA
AGGCCGGCTGACCGGTGAGCGTCAGACGGTGCATCACCCGCAGACGGAAGCACTGCTCTGGCAGCATGAG
ACCAGACACGCTTACAACGCGCAGGGGCTGGCGAACCGCTGTATACCGGACAGCCTGCCCGCCGTGGAAT
GGCTGACCTATGGCAGCGGCTGGCTGGCAGGCATGAAGCTCGGCGACACACCGCTGGTGGATTTCACCCG
CGACCGCCTGCACCGGAAAACGCTGCGCAGATTCGGCCGTTATGAACTCACCACCGCTTATACCCCTGCC
GGGCAGTTACAGAGCCAGCACCTGAACAGCCTGCAGTATGACCGCGATTACACCTGGAACGACAACGGCG
AACTCATCCGCATCAGCAGCCCGCGCCAGACCCGGAGTTACAGCTACAGCGACTCCGGCAGGCTGACCGG
CGTTCACACCACCGCAGCGAATCTGGATATCCGCATCCCGTATGCCACGGACCCGGCAGGTAACCGCCTG
CCCGACCCGGAGCTGCACCCGGACAGCACCCTCAGCATGTGGCCGGATAACCGTATCGCCCGTGACGCGC
ACTATCTTTACCGGTATGACCGTCACGGCAGGCTGACAGAGAAAACCGACCTCATCCCGGAAGGGGTTAT
CCGCACGGATGATGAGCGGACTCACCGGTACCATTACGACAGTCAGCACCGGCTGGTGCACTACACGCGG
ACACAATATGAAGAGCCGCTGGTCGAAAGCCGCTATCTTTACGACCCGCTGGGCCGCAGGGTGGCAAAAC
GGGTGTGGCGACGTGAACGGGACCTGACGGGCTGGATGTCGCTGTCACGGAAACCGCAAGTGACCTGGTA
CGGCTGGGACGGCGACCGGCTGACCACAATACAGAACGACAGAACCCGCATCCAGACGATTTATCAGCCG
GGGAGCTTCACGCCACTCATCAGGGTTGAAACCGCCACCGGTGAGCTGGCGAAAACGCAGCGCCGCAGCC
TGGCGGATGCGCTTCAGCAGTCCGGCGGCGAAGACGGTGGCAGTGTGGTGTTCCCGCCGGTGCTGGTGCA
GATGCTCGACCGGCTGGAAAGTGAAATCCTGGCTGACCGGGTGAGTGAGGAAAGCCGCCGCTGGCTGGCA
TCGTGCGGCCTGACTGTGGCGCAGATGCAAAGCCAGATGGACCCGGTATACACGCCGGCGCGAAAAATCC
ACCTGTACCACTGCGACCATCGCGGCCTGCCGCTGGCGCTTATCAGTGCGGAAGGGGCAACAGAATGGTG
CGCAGAATACGATGAATGGGGCAACCTGCTGAATGAAGAGAACCCGCATCAGCTGCAGCAGCTTATCCGC
CTGCCGGGGCAGCAGTATGATGAGGAGTCCGGCCTGTATTACAACCGCCACCGCTATTATGACCCGCTGC
ACGGGCGATATATCACTCACGATCCGATTGGACTGAAGGGGGGATGGAATTTTTATCAGTATCCGTTGAA
TCCGGTCATCAATGTGATCCGCAAGTTGGTTGATGTTTTTCCTAGACCATTCCCCTTGCCAATTCCATGG
CCCAAAAGCCCTGCACAGCAGCAAGCAGATGATAATGCTGCAAAAGCATTGACAAAATGGTGGAACGATA
CAGCATCACAAAGAATATTTGACTCTCTAATATTGAATAATCCGGGACTAGCATTAGATATAACAATGAT
AGCTTCTCGTGGAAATGTTGCAGACACAGGGATAACTGATCGTGTCAATGACATAATAAATGACAGATTC
TGGAGTGATGGGAAAAAACCCGACAGATGTGACGTACTTCAGGAACTAATTGATTGTGGTGATATTAGTG
CTAAAGATGCAAAAAGCACACAGAAAGCCTGGAATTGTCGTCACTCCAGACAGTCAAACGATAAAAAAAG
ATAG

Reference
(1) Ma J, Sun M, Dong W, Pan Z, Lu C, Yao H (2017). PAAR-Rhs proteins harbor various C-terminal toxins to diversify the antibacterial pathways of type VI secretion systems. Environ Microbiol. (1):345-360. [PudMed:27871130] experimental
 
experimental experimental literature