SecReT6
Effector Protein ID: 158512115
evpP
SecReT6 ID791
T6SS typeA4b
Gene symbolevpP
Locus tagEvpP
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]3625..4182 [+]
ProductEvpP
Effector typeProtein
Homologous effectorEvpP
DescriptionEvpP
UniProt IDA8YQR4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 185 a.a.     [Download]
>gi|158512115|ref|ABW69080.1| EvpP [Edwardsiella tarda]
MSILNSELDWSHVGSISTGPGTVVSDAFNISYGLPTKELLPAGTALYKFNGFSSLARPPITDDTPLSPWW
SPVQPFRHDGGLQQRMLVAKLNGVSMREWGRLTSVIKENWSSLDHLLEIVLKVPVYAWFGGFKGMSRIDN
GMPSKRNITLEQKGRGSNLPGGATQFYIPNLTVGHISSHNFSALK
-
Nucleotide Sequence: 558 bp     [Download]
>gi|158512110|gb|AY424360|evpP|:3625-4182
ATGTCGATTTTGAATTCGGAGCTGGACTGGTCCCATGTCGGGAGTATTTCTACAGGCCCAGGCACCGTCG
TCAGTGATGCATTTAACATATCCTATGGGCTGCCGACGAAAGAGCTGCTTCCGGCGGGAACAGCCTTATA
CAAATTCAATGGATTTAGTTCATTGGCAAGGCCCCCGATCACTGACGATACCCCACTGTCTCCCTGGTGG
AGCCCGGTCCAGCCATTCCGCCACGATGGCGGTCTGCAGCAGCGTATGCTGGTCGCTAAGCTAAACGGCG
TATCAATGAGGGAGTGGGGACGACTCACCTCTGTCATCAAAGAAAACTGGAGTTCTCTCGACCATTTACT
TGAGATAGTCCTAAAGGTTCCCGTCTATGCCTGGTTTGGGGGATTTAAGGGCATGTCGCGTATTGATAAT
GGTATGCCCTCTAAACGAAATATCACGCTGGAACAAAAAGGCAGGGGATCGAACCTCCCCGGCGGGGCCA
CACAGTTCTATATTCCAAACCTGACGGTTGGGCATATCAGTAGCCACAACTTTTCAGCCTTGAAATAA

Reference
(1) Hu W et al. (2014). A Disordered Region in the EvpP Protein from the Type VI Secretion System of Edwardsiella tarda is Essential for EvpC Binding. PLoS One. 9(11):e110810. [PudMed:25401506] experimental
(2) Zheng J et al. (2007). Dissection of a type VI secretion system in Edwardsiella tarda. Mol Microbiol. 66(5):1192-206. [PudMed:17986187] experimental
 
experimental experimental literature