SecReT6
Effector Protein ID: 158512116
evpI
SecReT6 ID791
T6SS typeA4b
Gene symbolevpI
Locus tagEvpI
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]14394..16379 [+]
ProductEvpI
Effector typeProtein
Homologous effectorEvpI
Descriptiontype VI secretion system Vgr family protein
UniProt IDA8YQR5, A8YQR5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-79, Aligned region: 29..330
Phage_base_V [PF04717], Evalue: 8.90E-24, Aligned region: 199..218
Phage_base_V [PF04717], Evalue: 8.90E-24, Aligned region: 366..458
Protein Sequence: 661 a.a.     [Download]
>gi|158512116|ref|ABW69081.1| EvpI [Edwardsiella tarda]
MGLTSDSRLLSLSTPLGKDALQVVQCRGEEAIADLYRFELELFSTDPALAWQSLVGQAAALRLALPNGQT
RYWHGVIGRAAYRGAEQHGFAYYAELVPRLAWLQHAQECQIFQEKTVPQIIEAVLKARGISDFRLSLSQR
YAPREYCVQYRESDLSFISRLMEEEGIFYWFEHSESRHVLVLADGNAAVQPCKVRSDIVYRPKHRSESGD
DIQWWMPSLAVVPANVFLNAYTFEQPTAHLLTSSASVAKQGKLSDVAVYDFTDDYTQTREGERRAKLKME
GLEAMQARIEGGGRCRTLAPGYGFSLQKHFRKDCNGDYLLLSVRHEIVNNLPWQEQEVNYQNHFICLPKS
LPYRTLSQTPRPVMHGVQTAVVTGPQGEEIHTDRHGRVKVHFHWDRLGTQDDKSSCWIRVAQGWAGLGWG
GMQLPRVGQEVIVDFVDGNPDAPLITGRVYNAHQTPPFKLPDNKTQSGIQTRSTPNGNPEHFSLLRFEDK
MGAEEVFMQAERDFRRRVKHDDELTVEHDRRVTIKNDCAETVSEGNYLQSITKGKHTRVIEGDALTEVKS
GNSTLQVNKGDHATTASAGSLHLKAGTAITLSVGSNRIVIDSGGVLIEGMNITVKGKQSIALSGLSVAIT
GTQSASLSSSAEAEVSSSVMTSIKGGIVKIN
-
Nucleotide Sequence: 1986 bp     [Download]
>gi|158512110|gb|AY424360|evpI|:14394-16379
ATGGGATTAACGTCGGATAGCCGGCTGTTGTCCTTGTCCACCCCGCTGGGCAAGGATGCCTTACAGGTGG
TGCAGTGCCGGGGCGAAGAGGCGATCGCCGATCTCTACCGCTTTGAGCTGGAGCTGTTCTCCACGGACCC
CGCGCTGGCGTGGCAATCGCTGGTCGGGCAGGCCGCCGCGCTGCGGCTGGCCTTGCCGAATGGCCAGACC
CGCTACTGGCATGGCGTGATCGGCCGGGCCGCCTACCGGGGCGCCGAGCAACACGGATTTGCCTATTATG
CCGAGCTGGTACCGCGCCTGGCCTGGCTGCAGCACGCCCAGGAGTGTCAGATCTTCCAGGAGAAGACGGT
CCCGCAGATTATTGAAGCGGTGCTTAAGGCGCGGGGCATCAGCGATTTTCGCCTCTCGCTGTCGCAGCGC
TACGCCCCCCGGGAATACTGCGTACAGTATCGCGAATCGGACCTCAGCTTCATCAGCCGACTGATGGAGG
AAGAGGGCATTTTCTACTGGTTCGAACACAGCGAAAGCCGCCATGTGCTGGTATTGGCCGATGGCAATGC
CGCGGTCCAACCCTGCAAGGTGCGCTCAGACATCGTCTATCGACCTAAGCATAGGAGCGAATCCGGCGAT
GATATCCAGTGGTGGATGCCCTCCCTCGCGGTCGTGCCGGCCAACGTCTTCCTGAATGCCTATACCTTTG
AGCAGCCGACCGCCCATTTGCTGACCTCCAGCGCCTCCGTGGCCAAGCAGGGCAAATTGAGCGACGTGGC
GGTCTACGATTTCACCGATGACTATACGCAGACCCGGGAGGGCGAACGCCGCGCCAAGCTGAAGATGGAG
GGGCTAGAGGCCATGCAGGCCCGGATAGAGGGCGGCGGACGCTGCCGCACGCTGGCGCCGGGCTATGGGT
TCAGCCTGCAAAAACATTTCCGCAAAGACTGTAACGGTGACTATCTGCTGCTAAGCGTACGGCACGAGAT
CGTCAACAACCTGCCGTGGCAGGAGCAAGAGGTGAACTACCAGAACCACTTTATCTGTCTCCCCAAATCC
CTGCCCTACCGCACCCTAAGCCAAACGCCCCGTCCGGTGATGCATGGCGTACAGACTGCCGTGGTCACCG
GTCCGCAGGGCGAGGAGATCCATACCGATCGGCATGGCCGGGTTAAGGTTCATTTTCACTGGGATCGCCT
GGGAACGCAGGATGATAAAAGCTCCTGCTGGATCCGGGTGGCGCAGGGCTGGGCCGGGCTGGGCTGGGGG
GGGATGCAGCTGCCCCGCGTAGGGCAGGAGGTGATCGTGGATTTTGTCGATGGCAATCCGGATGCCCCCC
TGATCACCGGCCGGGTCTATAACGCCCACCAGACGCCCCCCTTCAAGCTGCCTGACAATAAGACCCAAAG
CGGCATTCAGACCCGCAGCACCCCCAATGGCAATCCGGAGCACTTCAGCCTGCTGCGCTTCGAGGACAAG
ATGGGGGCGGAAGAGGTGTTCATGCAGGCGGAGCGGGATTTTCGCCGCCGGGTGAAACACGATGACGAGC
TGACGGTCGAGCACGACCGCCGGGTGACCATCAAGAATGACTGCGCCGAGACGGTCTCCGAGGGGAACTA
CCTGCAGAGCATCACCAAGGGCAAGCATACCCGGGTGATCGAGGGCGATGCCCTCACGGAGGTGAAGTCA
GGCAACAGTACGCTGCAGGTGAACAAGGGGGATCATGCCACCACCGCCTCGGCGGGCAGCCTCCATCTGA
AGGCAGGAACCGCGATAACCCTGAGCGTGGGCAGCAACCGTATCGTCATTGACAGCGGCGGCGTGCTCAT
CGAGGGCATGAATATCACGGTGAAGGGGAAACAGTCCATTGCGCTATCCGGCCTCAGCGTCGCGATAACG
GGCACCCAATCGGCCAGCCTGAGCAGTTCGGCAGAGGCGGAGGTCTCCTCGTCCGTGATGACCTCCATCA
AGGGCGGCATTGTCAAGATCAACTGA

Reference
(1) Zheng J et al. (2007). Dissection of a type VI secretion system in Edwardsiella tarda. Mol Microbiol. 66(5):1192-206. [PudMed:17986187] experimental
 
experimental experimental literature