SecReT6
Effector Protein ID: 15890633
-
SecReT6 ID16
T6SS typeA5
Gene symbol-
Locus tagAtu4350
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1484901..1485737 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorAtu4350 (Tde1)
DescriptionTde1; DNase Effector
UniProt IDA9CGH1
KEGG IDatu:Atu4350
PDB ID6ITW
Domain hit(s) vs Pfam Toxin_43 [PF15604], Evalue: 1.10E-42, Aligned region: 100..245
Protein Sequence: 278 a.a.     [Download]
>gi|15890633|ref|NP_356305.1| hypothetical protein Atu4350 [Agrobacterium tumefaciens str. C58]
MSATTTVAGAGGAIAGGWLGRVIGGLAGSLAGPGGTAVGAWIGGQVGAMAGRAAASAIASYMEDANVDAD
AKTKESEQAKPCVDCGEIDCFSPPEGATPKQVEEFRRQLKEQQDEINRMEPDDLVRNIDKYRQQGRPTDD
AANRRQSREDYRTDRTRELEEKYLSKGRNDYKEQAANDVAEEMKKLAATHTLDLVAGGDGSISGLGDKSI
NSSLGSQWKGRRSEQLRSHAKKAAEQKKKMNAKLEECKPEGGNDNSPDAETPDNGTGKGDGNPDVPVS
-
Nucleotide Sequence: 837 bp     [Download]
>gi|159185562|ref|NC_003063.2|:1484901-1485737 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGAGTGCGACGACAACTGTCGCCGGAGCGGGCGGTGCTATCGCAGGAGGTTGGCTCGGTCGTGTTATTG
GAGGCTTAGCTGGCAGCCTCGCTGGGCCTGGAGGTACAGCGGTTGGAGCATGGATAGGTGGGCAAGTCGG
CGCTATGGCGGGTAGAGCGGCTGCCTCCGCAATCGCCTCTTATATGGAAGATGCGAATGTAGACGCTGAC
GCCAAGACCAAGGAGAGCGAACAGGCCAAACCTTGCGTTGATTGTGGGGAAATCGATTGCTTTAGTCCGC
CTGAGGGAGCTACGCCTAAGCAAGTTGAAGAGTTTAGGCGTCAGTTGAAGGAGCAACAAGACGAAATAAA
CCGCATGGAGCCTGATGATCTGGTCAGAAATATCGACAAATATAGACAGCAGGGGAGGCCGACTGATGAT
GCAGCAAACCGTCGGCAGAGTAGAGAAGATTATCGCACCGACCGCACACGGGAACTGGAAGAAAAGTATT
TATCGAAAGGGCGCAATGACTATAAGGAACAGGCTGCGAATGATGTGGCAGAAGAGATGAAGAAGTTGGC
CGCAACCCATACCTTGGATTTGGTTGCGGGGGGCGACGGATCAATTTCTGGCTTGGGCGACAAGAGTATC
AATAGTTCTTTAGGGTCTCAATGGAAGGGAAGAAGATCGGAGCAATTGCGCTCTCATGCAAAAAAAGCGG
CTGAGCAAAAGAAAAAAATGAACGCTAAACTCGAAGAATGTAAACCCGAAGGCGGCAATGATAATTCTCC
CGATGCTGAAACTCCCGACAATGGTACAGGTAAGGGGGACGGCAATCCTGACGTCCCGGTGTCTTGA

Reference
(1) Ma LS et al. (2014). Agrobacterium tumefaciens Deploys a Superfamily of Type VI Secretion DNase Effectors as Weapons for Interbacterial Competition In Planta. Cell Host Microbe. 16(1):94-104. [PudMed:24981331] experimental
 
experimental experimental literature