SecReT6
Effector Protein ID: 15890638
-
SecReT6 ID16
T6SS typeA5
Gene symbol-
Locus tagAtu4345
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1479996..1480472 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorAtu4345
DescriptionHcp protein
UniProt IDA9CGG8
KEGG IDatu:Atu4345
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.80E-32, Aligned region: 4..134
Protein Sequence: 158 a.a.     [Download]
>gi|15890638|ref|NP_356310.1| hypothetical protein Atu4345 [Agrobacterium tumefaciens str. C58]
MPIYLQIDGIQGDATHEEHRKWMDIEAIHWNVARNMNTSAGSAANREASEPTISEVILTKVSDSSSTKLF
QEACAGRTGKLATIHLVTTGNPGNTYIEYLLTNTLIASYSVDSSGDRPVETIKLNFTKMEVKYTPFDDNN
SPQSPMIASYDLATTKAA
-
Nucleotide Sequence: 477 bp     [Download]
>gi|159185562|ref|NC_003063.2|:1479996-1480472 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGCCAATTTATCTGCAGATTGACGGTATCCAGGGCGACGCCACCCATGAAGAACATCGCAAGTGGATGG
ATATTGAAGCCATTCACTGGAACGTGGCCCGCAACATGAACACGTCGGCTGGTTCTGCTGCAAACCGCGA
AGCGTCCGAACCGACCATTTCGGAAGTCATTCTGACAAAGGTTAGCGACTCGTCTTCCACAAAGCTTTTC
CAGGAGGCCTGTGCTGGCCGCACTGGCAAGCTTGCAACGATTCATCTGGTGACGACCGGCAATCCGGGCA
ACACCTATATCGAATACCTGCTGACGAACACCCTTATCGCCAGCTACTCGGTGGATTCCAGCGGGGATCG
TCCGGTGGAGACCATCAAGCTCAACTTCACGAAAATGGAAGTGAAGTACACGCCGTTCGACGACAACAAC
TCGCCGCAGTCTCCGATGATCGCTTCCTACGATCTGGCGACGACCAAGGCTGCTTGA

Reference
(1) Wu HY et al. (2008). Secretome analysis uncovers an Hcp-family protein secreted via a type VI secretion system in Agrobacterium tumefaciens. J Bacteriol. 190(8):2841-50. [PudMed:18263727] experimental
 
experimental experimental literature