SecReT6
Effector Protein ID: 159184970
rbsB
SecReT6 ID16
T6SS typeA5
Gene symbolrbsB
Locus tagAtu1899
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003062] [Browse all T6SS(s) in this replicon]
Location [Strand]1875825..1876754 [-]
ProductABC transporter substrate-binding protein (ribose)
Effector typeProtein
Homologous effectorRbsB
Description
UniProt IDQ7CYA2
KEGG IDatu:Atu1899
PDB IDNA
Domain hit(s) vs Pfam Peripla_BP_4 [PF13407], Evalue: 2.70E-52, Aligned region: 29..284
Peripla_BP_1 [PF00532], Evalue: 6.30E-18, Aligned region: 27..292
Peripla_BP_6 [PF13458], Evalue: 3.10E-09, Aligned region: 54..256
Peripla_BP_3 [PF13377], Evalue: 3.60E-07, Aligned region: 27..78
Peripla_BP_3 [PF13377], Evalue: 3.60E-07, Aligned region: 151..296
Protein Sequence: 309 a.a.     [Download]
>gi|159184970|ref|NP_354876.2| ABC transporter substrate-binding protein (ribose) [Agrobacterium tumefaciens str. C58]
MKFSRILLTSAALLALSLGSANAAEVKKIGLAVANLQANFFNQIKQAVEAEAKTRGIAVVTVDAKGDGPT
QVNQIQDLLTQNIDALIYIPAGAAAATVPVKLAKAAGVPVINIDRNADGAPGDTFLATDSVASAKSVCDY
IIKQAGGAGKMVIIHGQKGTTPEVDRTKGCMESVKANSGVKIVAEQWSNMWSQDEGFQIMQNMLQANPDV
SIVFAQADGLALGAAQAIKVANPSQKIVVGGFDGDTAALEALKNGVFDVTATQQTQKMGRMAVEMAVKIV
GGEKVPAVQLSDATLTTKENVAGFIANHP
-
Nucleotide Sequence: 930 bp     [Download]
>gi|159184118|ref|NC_003062.2|:c1876754-1875825 Agrobacterium tumefaciens str. C58 chromosome circular, complete sequence
ATGAAATTTTCACGCATTCTGCTGACGTCCGCTGCCCTTCTTGCCCTGTCGCTCGGTTCGGCCAACGCCG
CCGAAGTCAAGAAGATCGGCCTTGCCGTCGCCAATCTGCAGGCGAACTTCTTCAACCAGATCAAGCAGGC
CGTCGAAGCCGAAGCCAAGACGCGCGGCATTGCCGTCGTTACCGTCGATGCCAAGGGCGATGGCCCGACG
CAGGTCAACCAGATCCAGGATCTGCTGACCCAGAATATCGACGCGCTGATCTATATCCCAGCCGGTGCCG
CTGCCGCCACCGTTCCGGTGAAGCTTGCGAAAGCTGCCGGCGTTCCGGTCATCAACATCGACCGCAATGC
CGATGGCGCGCCGGGTGATACCTTCCTTGCCACCGATTCCGTCGCTTCCGCCAAGTCGGTTTGCGATTAC
ATCATCAAACAGGCCGGTGGTGCCGGCAAGATGGTCATCATCCACGGCCAGAAGGGCACTACACCTGAAG
TCGACCGCACGAAGGGCTGCATGGAATCGGTCAAGGCCAATTCCGGCGTGAAGATCGTTGCCGAGCAATG
GTCCAACATGTGGAGCCAGGATGAAGGCTTCCAGATCATGCAGAACATGCTGCAGGCCAATCCCGACGTC
TCCATCGTCTTTGCACAGGCAGACGGTCTGGCGCTCGGCGCGGCGCAGGCAATCAAGGTTGCCAATCCGT
CGCAGAAGATCGTCGTTGGCGGCTTCGATGGCGATACGGCAGCGCTTGAGGCACTGAAGAATGGCGTCTT
CGACGTGACCGCGACGCAGCAGACCCAGAAGATGGGCCGCATGGCTGTCGAGATGGCCGTCAAGATCGTC
GGCGGCGAGAAGGTTCCGGCCGTCCAGCTCTCCGACGCGACGCTGACGACCAAGGAAAATGTCGCAGGCT
TCATCGCCAACCATCCCTGA