SecReT6
Effector Protein ID: 159186127
-
SecReT6 ID16
T6SS typeA5
Gene symbol-
Locus tagAtu4347
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1480980..1481480 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorAtu4347 (Tae4)
DescriptionTae; amidase
UniProt IDQ7CUP8
KEGG IDatu:Atu4347
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 6.50E-20, Aligned region: 41..158
Protein Sequence: 166 a.a.     [Download]
>gi|159186127|ref|NP_356308.2| hypothetical protein Atu4347 [Agrobacterium tumefaciens str. C58]
MRVNFDTLYSNYPSSDPSHPNYLSQRDLFTEIGWESFIGNPNYHNTCAIRVSIAFVKSGINIVPSSHRIQ
KGPYAGKGIEVNMRRLATLMKRTSYLGEPDPYTPATARNGIGARNGVVAFNNIPGYTGGGHIDLVRGGSE
ATQCASACYYNSETIWFWPLQASRGS
-
Nucleotide Sequence: 501 bp     [Download]
>gi|159185562|ref|NC_003063.2|:1480980-1481480 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGCGCGTTAACTTTGACACCCTCTATAGCAATTATCCGAGCAGCGATCCGTCGCATCCGAATTATCTCA
GCCAGCGTGATCTGTTCACGGAAATCGGCTGGGAGAGCTTCATCGGCAATCCGAACTATCATAATACCTG
CGCCATCCGCGTCAGCATCGCTTTCGTGAAGTCGGGCATCAACATCGTGCCCTCTTCGCACCGCATCCAG
AAGGGCCCCTATGCCGGAAAGGGCATCGAGGTGAACATGCGCCGCCTTGCCACCCTGATGAAGCGGACGA
GCTATCTCGGCGAGCCCGATCCTTACACGCCCGCCACCGCCCGCAACGGCATCGGCGCGCGCAACGGTGT
CGTGGCCTTCAACAATATTCCCGGCTACACCGGTGGCGGTCATATCGATCTCGTGCGCGGCGGGTCGGAA
GCCACCCAATGCGCGTCGGCCTGCTACTACAATTCGGAAACGATCTGGTTCTGGCCGCTGCAGGCCAGCC
GCGGGTCCTGA

Reference
(1) Ma LS et al. (2014). Agrobacterium tumefaciens Deploys a Superfamily of Type VI Secretion DNase Effectors as Weapons for Interbacterial Competition In Planta. Cell Host Microbe. 16(1):94-104. [PudMed:24981331] experimental
(2) Lin JS et al. (2013). Systematic Dissection of the Agrobacterium Type VI Secretion System Reveals Machinery and Secreted Components for Subcomplex Formation. PLoS One. 8(7):e67647. [PudMed:23861778] experimental
 
experimental experimental literature