SecReT6
Effector Protein ID: 160899271
-
SecReT6 ID236
T6SS typeA3
Gene symbol-
Locus tagDaci_3837
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4228393..4228875 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDA9BLI3
KEGG IDdac:Daci_3837
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-36, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|160899271|ref|YP_001564853.1| hypothetical protein Daci_3837 [Delftia acidovorans SPH-1]
MSVDMFMKVEGASGESQDSNHKGWTDIDSFTWGATQPNTMSSGGGAGAGKVSFHDLNVIAKVDKCYPAVL
KHCATGKHLGQVDISLCKAGGTQIEFTKITLTDVMVTNVTVSGANSSDTVTVNYSFQAAKVKTQYWEQTN
QGGKGAESQMGFNIKENREA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|160895450|ref|NC_010002.1|:c4228875-4228393 Delftia acidovorans SPH-1 chromosome, complete genome
ATGTCCGTTGATATGTTCATGAAGGTCGAGGGCGCCAGTGGCGAGTCCCAGGATTCCAACCACAAGGGCT
GGACCGACATCGACTCCTTCACCTGGGGTGCTACCCAGCCCAACACCATGTCCAGCGGCGGTGGTGCCGG
CGCCGGCAAGGTGAGCTTCCATGACCTGAACGTCATCGCCAAGGTGGACAAGTGCTACCCCGCCGTGCTC
AAGCACTGCGCCACGGGCAAGCACCTGGGCCAGGTCGACATCTCGCTGTGCAAGGCCGGCGGCACGCAGA
TCGAGTTCACCAAGATCACCCTGACCGACGTCATGGTGACGAACGTGACCGTCAGCGGCGCCAACTCCTC
TGACACCGTGACCGTGAACTACTCGTTCCAGGCTGCCAAGGTCAAGACCCAGTACTGGGAGCAGACCAAC
CAGGGCGGCAAGGGCGCCGAGAGCCAGATGGGCTTCAACATCAAGGAAAACCGCGAAGCCTGA