SecReT6
Effector Protein ID: 161502480
-
SecReT6 ID237
T6SS typeA2
Gene symbol-
Locus tagSARI_00524
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]523094..523462 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 0.00011, Aligned region: 17..88
NLPC_P60 [PF00877], Evalue: 0.00015, Aligned region: 23..95
Protein Sequence: 122 a.a.     [Download]
>gi|161502480|ref|YP_001569592.1| hypothetical protein SARI_00524 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MSWDKRMAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGAEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>ref|NC_010067.1|:c523462-523094 hypothetical protein SARI_00524 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAGTTGGGATAAAAGAATGGCGGTCAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTCACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACTTATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATCATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGTGCAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA