SecReT6
Effector Protein ID: 161504490
-
SecReT6 ID237
T6SS typeA2
Gene symbol-
Locus tagSARI_02603
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2520159..2523749 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSARI_02603
DescriptionV. cholerae VgrG3 fused to the predicted nuclease domain of the S. arizonae VgrG-NucSe1.
UniProt IDA9MMY5
KEGG IDses:SARI_02603
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.90E-61, Aligned region: 33..339
Pyocin_S [PF06958], Evalue: 2.40E-39, Aligned region: 912..1053
T6SS_Vgr [PF13296], Evalue: 7.40E-33, Aligned region: 471..576
T6SS_Vgr [PF13296], Evalue: 7.40E-33, Aligned region: 610..636
T6SS_Vgr [PF13296], Evalue: 7.40E-33, Aligned region: 1053..1075
Colicin-DNase [PF12639], Evalue: 3.10E-31, Aligned region: 1058..1194
DUF2345 [PF10106], Evalue: 4.50E-31, Aligned region: 603..727
Phage_base_V [PF04717], Evalue: 7.10E-13, Aligned region: 391..465
Protein Sequence: 1196 a.a.     [Download]
>gi|161504490|ref|YP_001571602.1| hypothetical protein SARI_02603 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MDNWLALFDGQTRYFLDINDSSVKPDVLRFYGREALSEPFRWDIEFTTLQANIPPEQVLMKYASFRMRSG
KSVHGMVTRLEWLSTSKDQSHYRLTLSSRLALLGYTRQCAVYQNQSVPEVVEQVLRKHGLEGPDFEFRLE
HTYPPREIITQWQETDLQFIQRILSEVGIYWRTMMDDVRDLDTYIFADSQLNYQFDVRLPYSEPSGLFDG
AAESVWDVRTWHNIATGTVVTRDYNYRTATTPMDAAVSVRSDAVTTGEHYRYAAPYREAGDDASPEPETE
SGAFYARLHHERELNRSARIHLFSNAAHLTPGQVLEPQGDVITALQEGVFLTLVTFRGARDSRLHVSVWG
QPYTERYCFRPVEIPRPVIPGTLPARIESREKNDTYAHLDEQGRYRVKLDFDREGTESGYGYLWLRMAKP
YAGDTLGWHTPLTDGTEVAIAYSNGDIDLPYIAYALHDSEHPDHVNRDNHTRNVLRTPANNKLRMEDRRG
EEHIKLATEYGKTQLNSGHLVNSKGETRGRGAELRTDEWGTLRAGKGLFVSADAQAKAQGEVLDMSAALE
EIDRLNQQLQQMEIAAEQAQALKADVDSQIRMFEQRLKPLSEALLMSAPEGMALTSGEHMQMTATKNVAI
NAGGDASIGAMGNMTALAGDKLGLFARTGQLSMKASEGPVEMQAQNAAMRLFAEKKLTMSSASDISFAGK
KRITLVGGGSYLRLEAGKVEYGTTASYLRKVKRTMAASASAKPVQAVSLPPPATMREFNPETLAPWVTPV
YAKSCLKEKGCTDAGTAEEPVDNFGQMTIFAQPVEDDCCGYGHQHEHADDEVVQHAQSAKKRKPDAGGEN
APAQATAAPLALGAATGLMTQVWGEWSLTGALGAARGIPYVGAMMSALYVPSAGEGSDRVPGRDEFWYEE
ELRQKSLTGAKATTRVRFFWRQDEQGNMRVYGVHTGEGTPYEGVRTAEMKWVEKNSRYEFKPAHGADVPL
ITWTPERPEGGDLPAHTGSDIKPIDQATILVTPIPDGKDEYTTPPFPMPEERDLNDYILVFPAGSGIKPV
YVYLKDDSRNQPGTATGNGVKLSGDKPWLDLSVTNKGNGAPIPSHIADKLRGRSYGSFDDLREDLWEEIS
NDPKLMAQFGEDNQERISNGLAPWVPSDGYYHGPNEVVKKFQIHHDQAIEDGGGVYDLDNLRIVTPRLHD
EIHYRR
-
Nucleotide Sequence: 3591 bp     [Download]
>ref|NC_010067.1|:c2523749-2520159 hypothetical protein SARI_02603 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGATAACTGGTTAGCGCTTTTTGACGGACAGACCCGATATTTTCTGGATATCAATGACAGTTCAGTGA
AGCCGGATGTTCTGCGCTTTTACGGCAGGGAAGCACTGAGCGAACCATTCCGCTGGGACATCGAGTTCAC
CACGCTTCAGGCGAATATCCCCCCGGAACAGGTGCTGATGAAATATGCCTCCTTCCGGATGCGGAGCGGC
AAAAGTGTGCACGGCATGGTGACCCGCCTGGAATGGCTTTCCACCTCAAAGGACCAGTCTCACTACCGTC
TTACGCTCAGTTCGCGCCTGGCACTCCTGGGATACACCCGACAGTGCGCGGTATATCAGAACCAGTCCGT
TCCTGAGGTGGTTGAGCAGGTGCTGCGTAAACACGGTCTGGAAGGTCCAGATTTTGAATTCAGACTGGAG
CATACGTACCCGCCGCGTGAAATTATCACTCAGTGGCAGGAGACGGATCTGCAATTCATCCAGCGTATTT
TGTCTGAGGTGGGAATTTACTGGCGCACGATGATGGACGATGTGCGCGATCTGGATACGTACATTTTTGC
CGACAGCCAGCTTAACTACCAGTTTGATGTGCGCCTGCCGTACAGCGAGCCATCGGGTCTGTTCGACGGC
GCGGCAGAATCGGTCTGGGATGTGCGGACCTGGCACAACATAGCCACCGGCACTGTCGTCACGCGGGATT
ACAACTACCGGACCGCCACCACGCCGATGGATGCGGCGGTGAGTGTGCGCAGTGATGCGGTCACCACCGG
GGAGCATTACCGCTACGCGGCACCTTATCGTGAAGCGGGCGATGACGCCAGCCCGGAGCCGGAAACCGAA
TCTGGCGCGTTCTACGCCCGACTTCACCACGAGCGGGAGCTCAACAGGTCGGCCCGCATTCACCTGTTCA
GCAATGCTGCACACCTCACTCCCGGGCAGGTGCTGGAGCCGCAGGGCGACGTCATTACGGCCCTGCAAGA
AGGCGTGTTCCTCACGCTGGTGACCTTCCGTGGCGCCCGTGATTCCCGTCTGCATGTGTCAGTCTGGGGC
CAGCCTTACACCGAACGTTACTGCTTCCGTCCGGTAGAGATCCCTCGCCCGGTCATCCCGGGTACGCTTC
CGGCCCGGATCGAAAGTCGCGAAAAAAATGATACCTACGCCCACCTGGACGAGCAGGGGCGCTATCGGGT
GAAACTGGACTTCGACCGGGAGGGGACGGAATCCGGTTACGGTTACCTGTGGCTGCGGATGGCGAAGCCG
TACGCCGGTGACACGCTGGGCTGGCATACGCCGCTCACCGACGGAACCGAAGTGGCGATTGCGTACAGCA
ACGGTGATATTGACCTGCCGTACATCGCGTATGCGCTTCACGACTCAGAACATCCGGACCATGTGAACCG
GGACAACCACACCCGCAACGTGCTGCGCACCCCGGCGAATAACAAGCTGCGGATGGAAGACAGGCGCGGG
GAAGAGCACATCAAACTCGCCACGGAGTACGGCAAGACGCAGCTCAACAGCGGGCACCTGGTGAACAGCA
AGGGAGAGACTCGCGGCAGAGGCGCAGAGCTGCGCACCGACGAGTGGGGAACACTGCGAGCCGGAAAGGG
GCTGTTTGTCAGCGCCGACGCGCAGGCGAAGGCACAGGGCGAGGTGCTGGATATGAGCGCCGCGCTGGAG
GAAATCGACAGGCTCAACCAGCAGTTGCAGCAGATGGAAATCGCGGCAGAGCAGGCGCAGGCGCTGAAGG
CGGATGTGGACAGCCAGATACGGATGTTTGAGCAGCGGCTGAAGCCGCTCAGTGAGGCGCTGCTGATGTC
CGCCCCGGAAGGGATGGCGCTGACCAGCGGGGAGCATATGCAGATGACGGCCACGAAAAACGTCGCGATA
AATGCGGGCGGCGACGCAAGTATCGGTGCGATGGGCAATATGACAGCGCTGGCCGGAGATAAACTGGGGC
TCTTTGCCCGTACGGGCCAGCTGAGCATGAAGGCCAGCGAAGGTCCGGTGGAAATGCAGGCGCAGAATGC
GGCTATGCGGCTGTTTGCGGAGAAGAAGCTGACGATGAGCTCAGCGAGTGACATCTCGTTTGCCGGGAAG
AAACGCATCACGCTGGTCGGTGGCGGGAGTTATCTGCGGCTGGAGGCGGGAAAGGTCGAGTATGGTACGA
CGGCGTCTTATTTACGCAAAGTGAAGCGGACGATGGCTGCATCAGCCAGTGCTAAACCTGTGCAAGCCGT
ATCCTTGCCGCCTCCGGCGACCATGCGAGAATTCAATCCCGAAACGCTCGCCCCCTGGGTGACGCCGGTG
TATGCAAAATCCTGCCTGAAGGAGAAAGGCTGCACGGATGCCGGAACTGCCGAAGAGCCCGTTGATAATT
TTGGACAGATGACAATTTTTGCCCAGCCTGTTGAGGACGACTGCTGCGGTTACGGTCATCAGCATGAGCA
TGCAGATGATGAAGTCGTTCAGCATGCACAGTCAGCCAAAAAACGTAAGCCTGACGCCGGGGGCGAAAAT
GCTCCAGCTCAGGCAACGGCTGCCCCGCTTGCTCTGGGAGCTGCTACTGGCTTGATGACCCAGGTCTGGG
GGGAATGGTCCCTGACCGGCGCATTGGGCGCGGCCCGGGGAATTCCGTATGTAGGCGCGATGATGTCCGC
GCTCTACGTTCCTTCTGCGGGTGAGGGGAGTGACAGGGTTCCTGGGCGAGACGAGTTCTGGTACGAGGAG
GAACTGCGGCAGAAATCCCTCACCGGAGCAAAAGCGACAACCCGGGTGAGATTCTTCTGGCGACAGGATG
AGCAGGGCAACATGCGGGTCTACGGCGTTCATACGGGGGAAGGCACCCCGTATGAAGGTGTGCGCACGGC
TGAAATGAAGTGGGTTGAAAAAAATAGCCGCTATGAGTTCAAACCAGCTCACGGAGCTGATGTTCCTCTG
ATTACCTGGACGCCCGAACGACCGGAGGGCGGCGATTTACCCGCTCATACAGGAAGCGACATAAAACCCA
TCGACCAGGCTACGATACTCGTCACGCCAATACCAGACGGAAAAGATGAATACACGACGCCGCCATTCCC
GATGCCGGAAGAGCGGGATCTTAACGATTACATTCTGGTGTTCCCTGCCGGTTCCGGGATTAAGCCGGTT
TATGTTTATCTGAAAGATGATTCACGAAATCAACCCGGAACAGCTACTGGCAACGGTGTAAAACTATCCG
GAGATAAACCCTGGCTAGATTTATCCGTAACAAACAAGGGAAATGGAGCCCCAATTCCAAGTCATATTGC
TGATAAGTTAAGAGGTAGAAGTTATGGATCTTTTGACGATCTAAGAGAAGATTTATGGGAAGAGATAAGT
AATGACCCAAAACTTATGGCTCAGTTTGGTGAAGATAACCAAGAACGTATTAGTAATGGGCTAGCACCTT
GGGTTCCATCAGATGGATACTATCATGGGCCAAATGAGGTTGTTAAAAAATTTCAGATACATCATGATCA
AGCGATTGAAGATGGCGGTGGTGTTTATGATTTAGATAATCTAAGAATCGTCACCCCTCGGTTACATGAT
GAGATTCACTATAGGAGGTAA

Reference
(1) Ho BT, Fu Y, Dong TG, Mekalanos JJ (2017). Vibrio cholerae type 6 secretion system effector trafficking in target bacterial cells. Proc Natl Acad Sci U S A. 114(35):9427-9432. [PudMed:28808000] experimental
 
experimental experimental literature