SecReT6
Effector Protein ID: 162419443
-
SecReT6 ID246
T6SS typeA3
Gene symbol-
Locus tagYpAngola_A2873
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3016106..3016591 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDA9R0N6
KEGG IDypg:YpAngola_A2873
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.40E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|162419443|ref|YP_001607254.1| hypothetical protein YpAngola_A2873 [Yersinia pestis Angola]
MAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHSGSGGGSGKASVSDFCFAHYIDKASPNLL
SYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMAGSLEDETRPREEIRFSFTKMTQDYVMQN
AEGHKSGVISANYDVKANMHS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3016106-3016591 Yersinia pestis Angola chromosome, complete genome
ATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGCCAATCACAAAAACG
AAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGCGGTTCAGGTGGCGG
TTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTAGCCCGAACTTATTG
AGCTATTGCTTGTTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGCTGGTGGCGATCCGC
TGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCGGGTTCTTTGGAAGA
TGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACTATGTTATGCAGAAT
GCTGAAGGCCATAAGTCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACATGCACAGCTAA