SecReT6
Effector Protein ID: 163856760
-
SecReT6 ID250
T6SS typeA1
Gene symbol-
Locus tagBpet2448
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2566203..2566688 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorBTH_II0868
DescriptionHcp protein
UniProt IDA9IN59
KEGG IDbpt:Bpet2448
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-38, Aligned region: 6..146
Protein Sequence: 161 a.a.     [Download]
>gi|163856760|ref|YP_001631058.1| unnamed protein product [Bordetella petrii DSM 12804]
MAMPCYLTLEGQNQGKIEGSCEVSGHEGKILVQAVDHSIELPKNPQTGLPSGKRQHLGITLVKEIDKSSP
KLYQALCSGEQLKSVVLEFYRISPKGTEEKYYTIKLEKAVIVATHLWVPNCLQPDNRQLGHMEDIGMTYE
KIVWTWEPDGIESEDSWLAPK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2566203-2566688 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCAATGCCGTGCTATCTGACCCTCGAAGGGCAAAACCAAGGCAAGATCGAAGGGTCTTGCGAAGTCA
GCGGACACGAGGGAAAGATCCTCGTGCAGGCCGTCGACCATTCCATCGAACTGCCCAAGAACCCGCAAAC
CGGCCTGCCGTCGGGCAAGCGCCAGCACCTGGGCATCACCCTGGTGAAGGAAATCGACAAATCTTCGCCC
AAGCTGTACCAGGCGCTGTGCTCGGGCGAACAGCTGAAATCCGTGGTGCTGGAGTTCTACCGTATCAGCC
CCAAGGGCACGGAAGAAAAGTACTACACCATCAAGCTTGAAAAAGCGGTGATCGTGGCGACCCACCTGTG
GGTGCCGAACTGCCTGCAGCCCGACAACCGCCAGTTGGGGCACATGGAAGACATCGGCATGACCTACGAG
AAGATCGTCTGGACGTGGGAGCCGGACGGCATCGAATCGGAAGATTCGTGGCTGGCGCCGAAGTAA