SecReT6
Effector Protein ID: 16759263
-
SecReT6 ID24
T6SS typeA3
Gene symbol-
Locus tagSTY0300
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]314246..314647 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY0300
DescriptionTae2_TY
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 133 a.a.     [Download]
>gi|16759263|ref|NP_454880.1| hypothetical protein STY0300 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MPYVYANAKALQDTEKVGNHHQCVELIQHYIRVGQASTWQQGAAVFGNKNIEVGTVIATFVNGRYPNHNS
GNHAAFFLGQDTGGIWVMDQWKDDIAKPRVSKRYIRKLHNGSVRSDGTYIRMSNNAEAYFIVE
-
Nucleotide Sequence: 402 bp     [Download]
>gi|16758993|ref|NC_003198.1|:314246-314647 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGCCATATGTTTATGCTAATGCAAAGGCTTTACAGGATACAGAAAAGGTAGGAAACCACCATCAGTGTG
TTGAACTTATTCAACACTATATACGAGTAGGACAAGCGAGTACATGGCAGCAAGGGGCCGCAGTATTTGG
AAACAAAAACATTGAAGTCGGGACAGTTATCGCTACTTTTGTGAATGGGCGATATCCGAACCACAATAGT
GGCAACCATGCTGCATTTTTTTTGGGGCAAGATACTGGCGGGATATGGGTGATGGATCAATGGAAAGATG
ATATCGCAAAACCCCGTGTGTCCAAACGTTATATAAGAAAGTTGCATAATGGAAGTGTTCGTAGTGACGG
GACTTATATAAGGATGAGTAATAATGCAGAAGCCTATTTTATCGTTGAATAG