SecReT6
Effector Protein ID: 16759265
-
SecReT6 ID24
T6SS typeA3
Gene symbol-
Locus tagSTY0302
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]315281..315766 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSciK
DescriptionHcp protein
UniProt IDQ93IS5
KEGG IDstt:t2584, sty:STY0302
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|16759265|ref|NP_454882.1| hypothetical protein STY0302 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
-
Nucleotide Sequence: 486 bp     [Download]
>gi|16758993|ref|NC_003198.1|:315281-315766 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGCTTATGACATTTTTTTAAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACTAATCTGGATTTTGATCACTATATCGATCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTCGAGCTTTCTTTCAGCACTGTGAAACAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACTATCACCGCAGGTTACGACTTCAAGGCGAACAAAGAAATTTAA

Reference
(1) Wang M et al. (2011). Molecular characterization of a functional type VI secretion system in Salmonella enterica serovar Typhi. Curr Microbiol. 63(1):22-31. [PudMed:21487806] experimental
 
experimental experimental literature