SecReT6
Effector Protein ID: 16761300
-
SecReT6 ID24
T6SS typeA3
Gene symbol-
Locus tagSTY2606
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]2441934..2442302 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY2606
DescriptionTae3_TY
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 9.80E-05, Aligned region: 17..88
NLPC_P60 [PF00877], Evalue: 0.00015, Aligned region: 23..95
Protein Sequence: 122 a.a.     [Download]
>gi|16761300|ref|NP_456917.1| hypothetical protein STY2606 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MSWDKRVAVNYAKTHAGSHSQGRCAEFTRKAIQAGGITLGHTYHAKDYGPMLRSAGFTAIGTYEMPREGD
VIIIQPYAGGNPSGHMAIYDGAEWYSDFKQRDMWAGPGYRAARPSYTIYRKN
-
Nucleotide Sequence: 369 bp     [Download]
>gi|16758993|ref|NC_003198.1|:2441934-2442302 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGAGTTGGGATAAAAGAGTGGCGGTTAATTATGCCAAAACGCATGCAGGTTCTCATTCTCAAGGCCGGT
GTGCGGAATTTACCCGAAAGGCAATTCAGGCGGGCGGTATCACGCTGGGGCATACATATCATGCGAAAGA
TTATGGCCCAATGTTAAGAAGCGCCGGATTCACCGCTATTGGTACCTATGAAATGCCGCGCGAGGGTGAC
GTCATCATTATTCAACCTTACGCTGGCGGAAACCCGAGCGGTCACATGGCGATATACGATGGCGCAGAGT
GGTATTCAGATTTTAAACAACGCGATATGTGGGCCGGCCCGGGCTACCGGGCAGCCAGGCCCTCATATAC
CATCTACAGGAAGAATTAA

Reference
(1) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature