SecReT6
Effector Protein ID: 16761909
-
SecReT6 ID24
T6SS typeA3
Gene symbol-
Locus tagSTY3300
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconchromosome [GenBank: NC_003198] [Browse all T6SS(s) in this replicon]
Location [Strand]3146822..3147307 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDQ8Z3S0
KEGG IDsty:STY3300, stt:t3052
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|16761909|ref|NP_457526.1| hypothetical protein STY3300 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLN
EYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIKWQITAEKS
DGAQQESRASVWDLAMDQIGK
-
Nucleotide Sequence: 486 bp     [Download]
>gi|16758993|ref|NC_003198.1|:c3147307-3146822 Salmonella enterica subsp. enterica serovar Typhi str. CT18 chromosome, complete genome
ATGGATGCGATTTTTTTAAAGCTCGACAATATCAAAGGCGAAAGCCAGGTTGAAGGCTTTGAAGATCAGA
TAGAGATCATGTCTTATAGCCACAATGTGGCAATGCAGGTAAATAACGATGTTAGCCTCACTGAGCGGAC
TTCCGGGCGTGCGCATGTTGGTGAAATGTCGCTCACCAAATTTGTCGACCTCGCCACGCCTGTGCTCAAT
GAGTACTGCTGTAGCGGGAGGCTAATTAGAACCGCGGTGCTGACGTTGTGCCGCAATGACGACGGCAAAA
TGCGGTCGCTTATCGTTTATACCCTGACAAACGTGCTGATATCACAACTCAGTGTTAGCGGCGGCGCCGG
CGGTAAGCCGGTGGAAACGATGTCGCTGAACTTCACGAAAATCAAATGGCAAATCACTGCCGAGAAATCA
GACGGCGCTCAACAGGAGTCCAGAGCGTCAGTATGGGATCTGGCGATGGACCAGATAGGGAAATGA