SecReT6
Effector Protein ID: 169633798
-
SecReT6 ID254
T6SS typeA4b
Gene symbol-
Locus tagABSDF2249
StrainAcinetobacter baumannii SDF
Repliconchromosome [GenBank: NC_010400] [Browse all T6SS(s) in this replicon]
Location [Strand]2078484..2078987 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorA1S_1296
DescriptionHcp protein
UniProt IDB0VRQ4, B0VRQ4
KEGG IDabm:ABSDF2249
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|169633798|ref|YP_001707534.1| hypothetical protein ABSDF2249 [Acinetobacter baumannii SDF]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
-
Nucleotide Sequence: 504 bp     [Download]
>gi|169632029|ref|NC_010400.1|:c2078987-2078484 Acinetobacter baumannii SDF chromosome, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
AGGCGGCCACACTGCTGAACGTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCTGGTTATACATTTGATGAAGTACAAATCGACTTCTATCGTGCAA
ATGGTGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTCTAGTTTCTAGTGTAACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA

Reference
(1) Weber BS et al. (2013). Genomic and Functional Analysis of the Type VI Secretion System in Acinetobacter. PLoS One. 8(1):e55142. [PudMed:23365692] experimental
 
experimental experimental literature