SecReT6
Effector Protein ID: 169796452
-
SecReT6 ID255
T6SS typeA4b
Gene symbol-
Locus tagABAYE2413
StrainAcinetobacter baumannii AYE
Repliconchromosome [GenBank: NC_010410] [Browse all T6SS(s) in this replicon]
Location [Strand]2461269..2461772 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorA1S_1296
DescriptionHcp protein
UniProt IDB0VB03, B0VB03
KEGG IDaby:ABAYE2413
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|169796452|ref|YP_001714245.1| hypothetical protein ABAYE2413 [Acinetobacter baumannii AYE]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
-
Nucleotide Sequence: 504 bp     [Download]
>gi|169794206|ref|NC_010410.1|:c2461772-2461269 Acinetobacter baumannii AYE chromosome, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAGTCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
GGGCGGCCACACTGCTGAACGTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCTGGTTATACATTTGATGAAGTACAAATCGACTTCTATCGCGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTTTAGTTTCTAGTGTGACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGAGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA