SecReT6
Effector Protein ID: 170023722
-
SecReT6 ID258
T6SS typeA3
Gene symbol-
Locus tagYPK_1481
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]1639755..1640324 [+]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorROD_27741
DescriptionHcp protein
UniProt IDB1JG38
KEGG IDypy:YPK_1481
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.30E-43, Aligned region: 34..164
Protein Sequence: 189 a.a.     [Download]
>gi|170023722|ref|YP_001720227.1| Hcp1 family type VI secretion system effector [Yersinia pseudotuberculosis YPIII]
MCLRIYMGSSYTRCLALSDIYKSAREDIMAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHS
GSGGGSGKASVSDFCFAHYIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMA
GSLEDETRPREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
-
Nucleotide Sequence: 570 bp     [Download]
>gi|170022262|ref|NC_010465.1|:1639755-1640324 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGTGCCTCCGTATTTATATGGGGTCTTCCTACACTCGATGTTTGGCATTGAGTGACATTTATAAAAGTG
CTAGAGAGGATATTATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGC
CAATCACAAAAACGAAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGC
GGTTCAGGTGGCGGTTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTA
GCCCGAACTTATTGAGCTATTGCTTGCTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGC
CGGTGGCGATCCGCTGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCG
GGTTCTTTGGAAGATGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACT
ATGTTATGCAGAATGCTGAAGGCCATAAATCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACAT
GCACAGCTAA