SecReT6
Effector Protein ID: 170025764
-
SecReT6 ID260
T6SS typeA3
Gene symbol-
Locus tagYPK_3549
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]3905334..3905687 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorYpk_3549
DescriptionZn2+-binding protein substrate YezP has the capacity to rescue the sensitivity to oxidative stress exhibited by T6SS-4 mutants when added to extracellular milieu.
UniProt IDA0A0H3B7J5
KEGG IDypy:YPK_3549
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 117 a.a.     [Download]
>gi|170025764|ref|YP_001722269.1| hypothetical protein YPK_3549 [Yersinia pseudotuberculosis YPIII]
MLDPKNIQNVLKSSTDLGQQSQSDLQKPFVKGMQNMEMSGADAARSIMQSVNQSCETMMSDMNKILGGLQ
DNVDAHQKMQSEERPKDFERAMSDLRSTLSNGFPEEMKSMFDKLPKM
-
Nucleotide Sequence: 354 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c3905687-3905334 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGCTAGATCCTAAAAACATCCAGAATGTATTGAAGTCATCTACTGACCTTGGTCAGCAATCTCAATCTG
ATTTGCAGAAACCTTTTGTAAAAGGAATGCAAAATATGGAGATGTCAGGGGCCGATGCCGCTCGCAGTAT
CATGCAATCGGTTAATCAATCCTGCGAAACCATGATGAGCGATATGAATAAGATATTGGGAGGATTGCAG
GACAATGTTGATGCTCACCAGAAAATGCAAAGTGAGGAGCGTCCGAAGGACTTCGAGAGAGCCATGAGTG
ATCTTCGCAGCACACTCTCCAATGGTTTCCCAGAGGAAATGAAAAGTATGTTTGATAAATTGCCCAAAAT
GTAG

Reference
(1) Wang T et al. (2015). Type VI Secretion System Transports Zn2+ to Combat Multiple Stresses and Host Immunity. PLoS Pathog. 11(7):e1005020. [PudMed:26134274] experimental
 
experimental experimental literature