SecReT6
Effector Protein ID: 170721679
-
SecReT6 ID261
T6SS typeA4b
Gene symbol-
Locus tagPputW619_2498
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2773428..2773946 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorPsyr_4965
DescriptionHcp protein
UniProt IDB1J8G5
KEGG IDppw:PputW619_2498
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.00E-41, Aligned region: 6..146
Protein Sequence: 172 a.a.     [Download]
>gi|170721679|ref|YP_001749367.1| Hcp1 family type VI secretion system effector [Pseudomonas putida W619]
MAFDAYIQIDGIPGEVLDEKHKDWIEVLGYEYGATQATSATASSSGGASSERVSLTDFKIRKAVDKASAK
LFEHCCTGKHIAKLKLNVNRAGGDKVTYLTIDMEEVVVSSVKFVAGGNQGGEDKAVSDLPIEEISFNFAR
IKTTYTQQNRTDGQAGGNIVGGWDRTANKVFA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2773946-2773428 Pseudomonas putida W619 chromosome, complete genome
ATGGCATTTGACGCGTATATCCAAATCGACGGCATCCCGGGCGAAGTTCTGGATGAAAAACACAAGGACT
GGATCGAAGTGCTGGGCTACGAGTACGGCGCCACCCAGGCCACTTCGGCCACTGCCAGCTCCTCGGGCGG
TGCATCCTCCGAGCGCGTGTCGCTGACCGACTTCAAGATCCGCAAGGCAGTCGACAAGGCCTCGGCCAAA
CTGTTCGAGCACTGCTGCACCGGCAAGCACATCGCCAAGCTGAAGCTGAACGTCAACCGTGCCGGTGGTG
ACAAGGTCACCTACCTGACCATCGACATGGAAGAAGTGGTGGTGTCCTCGGTCAAGTTCGTCGCCGGTGG
CAACCAGGGCGGTGAAGACAAGGCGGTAAGCGACCTGCCGATTGAAGAAATCAGCTTCAACTTCGCCCGC
ATCAAAACCACCTACACCCAGCAGAACCGTACCGACGGCCAGGCTGGCGGCAACATCGTCGGTGGCTGGG
ACCGCACCGCGAACAAAGTGTTTGCCTAA