SecReT6
Effector Protein ID: 170722425
-
SecReT6 ID262
T6SS typeA2
Gene symbol-
Locus tagPputW619_3256
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3597244..3597747 [-]
ProductHcp1 family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDB1JAN3
KEGG IDppw:PputW619_3256
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-35, Aligned region: 6..146
Protein Sequence: 167 a.a.     [Download]
>gi|170722425|ref|YP_001750113.1| Hcp1 family type VI secretion system effector [Pseudomonas putida W619]
MAIPVYLWLKDDGGADIKGSVDVKGREGSVEVVGQDHDLYIPTDNNTGKLTGTRIHTPFVFTKEIDASSP
YLYKAVTTGQTLKEAEFKWYKINDAGQEVEYFNTKLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYE
KITWAFKDGNIIHSDSWNERPSAAAAG
-
Nucleotide Sequence: 504 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3597747-3597244 Pseudomonas putida W619 chromosome, complete genome
ATGGCTATTCCTGTTTATCTGTGGCTGAAAGACGATGGCGGAGCCGATATCAAAGGCTCGGTGGATGTAA
AGGGTCGTGAGGGTAGTGTTGAAGTGGTCGGTCAAGATCATGACCTGTATATCCCCACCGATAACAATAC
CGGCAAATTAACCGGTACGCGCATCCATACGCCTTTTGTTTTCACCAAGGAAATAGACGCGTCCTCTCCT
TATCTCTACAAGGCCGTGACCACGGGGCAGACGCTGAAAGAAGCAGAATTCAAGTGGTACAAAATCAATG
ATGCCGGGCAAGAGGTGGAGTATTTCAACACCAAATTGGAAAACGTCAAGGTCGTGAAAGTTGCACCAAA
AATGCACGACGTCAAAGACCCAGCGAAAGAAAAGCACAATCACTTGGAATTGGTCGAGCTGCGCTACGAA
AAGATCACCTGGGCATTCAAGGATGGGAACATCATCCATTCGGACTCTTGGAATGAACGCCCTAGCGCCG
CTGCGGCAGGGTAA