SecReT6
Effector Protein ID: 170733545
-
SecReT6 ID264
T6SS typeA4b
Gene symbol-
Locus tagBcenmc03_2209
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]2471828..2474515 [-]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorBTH_I2697
Descriptiontype VI secretion system Vgr family protein
UniProt IDB1JV70
KEGG IDbcm:Bcenmc03_2209
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-56, Aligned region: 35..341
DUF2345 [PF10106], Evalue: 7.00E-46, Aligned region: 668..822
T6SS_Vgr [PF13296], Evalue: 7.00E-30, Aligned region: 517..624
Phage_base_V [PF04717], Evalue: 8.10E-16, Aligned region: 385..498
Protein Sequence: 895 a.a.     [Download]
>gi|170733545|ref|YP_001765492.1| ImpA family type VI secretion-associated protein [Burkholderia cenocepacia MC0-3]
MDVVAALRGYSQATRHIQIDTVMAGAFAVERFHGREAVNESFRFEIDVLSSEPFLDLSPLIGSAARLRLA
TGAGERSWNGYVTHAAYADTDGEITRYRLTLESWLAFLHLRRNCLYFTDLDTMGICDRVFGDYPEAHWRY
DTSEAQRTYALRGQYRETDFAFVLRLLSEAGLSFHIEHAQEASGSKPSGNHTVVIADHRAERKNGASIGY
QIQDVGDPDGVITQFTERHQWVPDKVVATSWKASEVQALAGHAAAAADADAPVLPVREVFDGQRAGRFDT
SAQAQRYAEQRLDALRLPKTIHYGAGTARTLEVGKLHTLTGYLNRAHTFVPLSIEHEAVNNLGAQIGELL
KRGELTAGHYRNRFVAIPEGVPIIPPLVECPVVHGVQTAIVVGEPSASVSSTRDHQVRIQFPWMRGTAPL
RGGLTDTASRSNPAGHAPGDHRSGVLARIAEQAAGPNFGHVFTPRVGAEVVVGFDSGNIDQPVVLGQVYG
GRVKPPFAAGDGSGANHPGTLTGLQTQTLDGQPGSRWVMDDASGQLRHELGNSVADSRLAQGYLIDQQAS
TRGAYRGEGFELSTQGWAVARAGEGMLVSSTARPNAGSTQMDLAEGVGQLARAVETAKGLDAAATGAKAD
GLGGNQAQADFLKAIDPAQDGKYTGAVNGQGATKPMGKQRSGGDPVERFATAAVVFDSPANLVLTTPNSA
AAYAAEHVHLTAQGDVHVAADATVAGVSGDAVSFYSAAGGVKIIANHGPVTVEAHTSAMEILADQSIQVS
STEDRVDVLAKDTIVLQQGPNRITLSGADITVETPGQFQVKSGSHVFVGPQSAPPNLSPLPDSRERAFDE
GFILKDRDSGKPAAFRPYRITLANGDVQHGVTDELGHTHVVKTLASEILKIDVEG
-
Nucleotide Sequence: 2688 bp     [Download]
>gi|170731356|ref|NC_010508.1|:c2474515-2471828 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGGACGTCGTTGCGGCATTGAGGGGCTATTCGCAAGCCACTCGCCACATCCAGATCGATACGGTCATGG
CCGGAGCATTCGCAGTCGAACGCTTCCACGGTCGCGAGGCAGTGAACGAATCGTTTCGCTTCGAAATCGA
TGTGCTATCGAGCGAACCCTTTCTCGATCTCAGTCCGCTGATCGGCAGTGCCGCGCGCCTGCGACTCGCG
ACGGGGGCGGGTGAACGCAGTTGGAACGGCTACGTCACGCACGCGGCCTATGCCGATACCGACGGCGAGA
TCACGCGTTATCGGCTGACCCTGGAGTCGTGGCTCGCATTCCTGCACCTGCGTCGCAATTGCCTGTATTT
TACGGATCTCGACACGATGGGCATTTGCGATCGCGTGTTCGGCGACTATCCGGAAGCGCACTGGCGATAC
GACACCAGCGAAGCGCAGCGTACCTACGCGCTGCGTGGACAGTATCGCGAGACGGACTTTGCGTTCGTCC
TGCGGCTGCTGTCGGAAGCGGGCCTGTCGTTTCACATCGAGCATGCGCAGGAAGCCAGTGGATCGAAGCC
GTCCGGCAATCATACGGTCGTGATCGCGGACCACCGCGCCGAGCGGAAGAACGGCGCGTCGATCGGGTAT
CAAATCCAGGACGTGGGCGATCCCGACGGCGTCATCACGCAGTTCACGGAACGCCACCAGTGGGTGCCCG
ACAAGGTCGTCGCGACGAGCTGGAAGGCGAGCGAAGTGCAGGCGCTGGCCGGTCACGCCGCGGCTGCAGC
GGATGCGGATGCCCCCGTTCTTCCGGTACGCGAAGTGTTCGACGGCCAGCGGGCCGGCCGTTTCGATACG
TCGGCGCAAGCGCAGCGCTATGCCGAACAGCGGCTCGACGCGCTGCGCCTGCCCAAGACGATTCACTACG
GCGCAGGTACGGCGCGCACGCTGGAAGTCGGCAAGCTCCACACGCTGACCGGCTATCTGAACCGCGCGCA
CACGTTCGTGCCGCTGTCGATCGAACATGAGGCGGTCAACAACCTCGGCGCCCAGATCGGCGAGCTGTTG
AAGCGGGGGGAACTGACGGCCGGGCACTATCGCAATCGCTTTGTCGCCATACCCGAAGGGGTGCCGATCA
TTCCGCCGCTCGTCGAGTGTCCGGTCGTGCACGGCGTGCAGACCGCGATCGTGGTGGGCGAGCCGAGCGC
AAGCGTCAGCAGCACCCGCGATCATCAGGTGCGTATCCAGTTTCCCTGGATGCGCGGTACGGCACCGCTG
CGAGGCGGACTGACCGATACCGCGAGCCGGTCGAATCCGGCCGGGCATGCGCCCGGTGATCACCGGTCCG
GGGTGCTGGCGCGAATTGCCGAGCAGGCGGCCGGCCCGAATTTCGGGCATGTCTTTACGCCGCGTGTTGG
CGCGGAAGTCGTCGTGGGTTTCGATTCGGGCAACATCGACCAGCCCGTCGTGCTCGGACAGGTCTACGGC
GGGCGCGTGAAGCCGCCTTTTGCGGCCGGCGACGGCAGTGGCGCCAATCATCCCGGCACGCTGACCGGTC
TGCAGACGCAGACGCTCGACGGACAGCCGGGCAGCCGCTGGGTGATGGACGATGCGAGCGGCCAGTTGCG
CCACGAACTCGGCAATTCGGTGGCCGATAGCCGCCTCGCGCAGGGCTATCTGATCGACCAGCAGGCATCG
ACACGCGGTGCGTATCGGGGAGAAGGCTTCGAGCTGTCCACGCAAGGCTGGGCGGTCGCGCGCGCCGGCG
AAGGGATGCTGGTGTCCAGCACGGCCCGTCCCAACGCCGGCTCGACGCAGATGGATTTGGCGGAAGGCGT
CGGCCAGCTTGCACGGGCCGTCGAGACGGCAAAGGGGCTCGACGCCGCGGCGACCGGGGCAAAGGCGGAC
GGCCTCGGCGGCAACCAGGCACAGGCCGATTTCCTCAAGGCGATCGATCCGGCCCAGGACGGCAAATACA
CAGGGGCCGTCAATGGCCAGGGCGCGACCAAGCCCATGGGCAAGCAGCGCAGCGGCGGCGATCCGGTCGA
GCGGTTCGCCACCGCTGCCGTCGTATTCGATTCGCCGGCGAATCTCGTCCTGACCACGCCGAACAGTGCG
GCGGCCTATGCGGCGGAACACGTACACCTGACCGCGCAAGGCGATGTGCACGTCGCCGCCGATGCAACGG
TGGCGGGCGTTTCCGGCGACGCCGTGAGTTTCTACTCGGCGGCGGGAGGGGTGAAGATCATCGCGAACCA
CGGCCCGGTCACAGTGGAGGCGCATACGTCCGCGATGGAGATACTGGCCGACCAGTCGATCCAGGTTTCA
TCGACCGAAGACCGCGTCGACGTACTGGCGAAGGACACCATCGTGCTGCAGCAAGGCCCGAACAGGATCA
CACTCAGCGGCGCGGACATCACGGTCGAAACACCGGGGCAGTTTCAGGTGAAGTCCGGATCGCACGTATT
CGTCGGCCCGCAAAGTGCGCCGCCGAATCTTTCGCCATTGCCGGATTCCCGCGAACGCGCGTTCGACGAG
GGGTTCATTCTGAAGGATCGCGACAGTGGCAAGCCGGCCGCGTTTCGGCCGTACCGGATCACGTTGGCGA
ACGGCGACGTTCAGCATGGCGTGACGGATGAACTGGGACACACGCATGTGGTGAAGACCCTGGCTTCCGA
AATTCTCAAGATCGACGTCGAGGGCTGA