SecReT6
Effector Protein ID: 170733548
-
SecReT6 ID264
T6SS typeA4b
Gene symbol-
Locus tagBcenmc03_2212
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]2476634..2479579 [-]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorBTH_I2705
Descriptiontype VI secretion system Vgr family protein
UniProt IDB1JVI0
KEGG IDbcm:Bcenmc03_2212
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.10E-45, Aligned region: 37..357
DUF2345 [PF10106], Evalue: 6.60E-38, Aligned region: 539..556
DUF2345 [PF10106], Evalue: 6.60E-38, Aligned region: 742..899
T6SS_Vgr [PF13296], Evalue: 4.20E-29, Aligned region: 580..687
Phage_base_V [PF04717], Evalue: 7.30E-18, Aligned region: 424..521
Protein Sequence: 981 a.a.     [Download]
>gi|170733548|ref|YP_001765495.1| ImpA family type VI secretion-associated protein [Burkholderia cenocepacia MC0-3]
MDVLKSITTVFSANRLFSLEGRGGAIASLQVERWTGRERLSANFVWDVYALASDPALDLETMLGQRAALR
TTLTDGSIATRSGLVAQAECIGFDAGLARYHLQLVPWLAALEHGRDQRTFVNQSVADILDRIFREYGDIA
RWRYTADANQRIQTVGARDYVAQYRTHSNLDFVLHILAEAGLGFCFVEDDDAPAGHTMIVFDDSAQLPED
DTSTRRGGVPQRMSGATVEPDDAILGMGQSLTLMADRVTLLSSDYRGNQSVTGSASLGNTDGARELYDDV
GPEAFDGFRHADDAARRQADAIFSQARFWTGYSTVRTARCGRNVRVAGAAWRQHWRDEGRVPDTFLLTDV
AHVGVNNLPETVLEALERRLGPLRLPDVDARTLKQAEAGGYANRFEAVPREQVWRPTLDDGTGQRWNPAP
TAIGAQTAIVVGAQGEAEPGANVPVHTDGQGRIRLRFHWQAEGDKGTYPTRAMQRLASDGHGLQQTPRIG
QEVLVQFHHGLIHRPIVLGGLFNGQGEGGDTPTPGGAAAQPADASVYAQATDLAASGQGNVAGGNSPMWH
GAGGGADRHAHAGALSGFKSQGFDGQGANQLVTDDSDGMGRLQMSTTHAATQLNLGHLRYQADNYLGSFR
GQGFEIRTDAYGALRATRGALLTSYALRSGQPAGEASALQALFSQQAVLAESLDRAAGEHGTLPLAAQRG
TRQSARSRLDAGTVPLKSLERSLKTTVGQDGFSQALSDAKDRTVGKPLPHTGDALLGVAAQGGHGMLAGQ
GLQWAVGETLTLGSGADTNLAVNQTLRIHSGQGVGWLAGARAANGAGLTVVSGQDNLDLQAQHDALAVRA
KDVLNVASASANVELMGKTTAHLAVSGGAHITIEGGNVTFGCPGKLVIHAAQHQFAGATDFPREQGKWGD
LGQYNEYYHLHDAATGEPLKNLPYRMVGEGGEKLEGISRAGDGRTATFSTHSSSKPVRVEYTGNEDIEHG
W
-
Nucleotide Sequence: 2946 bp     [Download]
>gi|170731356|ref|NC_010508.1|:c2479579-2476634 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGGACGTATTGAAGTCAATAACGACAGTATTCAGCGCCAATCGCCTTTTCTCTCTTGAAGGCCGGGGTG
GCGCGATCGCGTCGCTTCAGGTCGAGCGCTGGACCGGGCGGGAGCGGTTGTCCGCGAATTTCGTCTGGGA
TGTCTACGCGTTGGCAAGCGATCCCGCGCTCGACCTGGAAACGATGCTCGGACAACGTGCCGCGTTACGT
ACGACGTTGACCGACGGCAGTATCGCGACCCGCAGCGGCCTCGTCGCGCAGGCCGAATGCATCGGTTTCG
ACGCGGGCCTGGCCCGCTACCACCTGCAGTTGGTACCTTGGCTCGCCGCGCTCGAGCATGGGCGTGACCA
GCGCACGTTCGTCAATCAATCGGTAGCCGATATTCTGGACCGGATATTTCGGGAATATGGCGATATCGCG
CGCTGGCGATATACCGCCGACGCAAACCAGCGAATTCAGACGGTGGGCGCGCGCGATTACGTCGCTCAAT
ATCGCACGCATAGCAATCTCGACTTTGTCCTGCACATTCTGGCCGAGGCCGGGTTGGGTTTTTGCTTCGT
CGAGGACGATGACGCGCCCGCCGGCCACACGATGATTGTTTTCGACGACAGCGCGCAATTGCCGGAAGAC
GATACGTCGACGCGTCGCGGTGGCGTGCCGCAGCGCATGAGTGGCGCGACGGTTGAACCGGACGATGCCA
TTCTCGGCATGGGTCAATCGCTCACGCTGATGGCCGATCGCGTGACGTTGCTCAGTAGCGATTACCGCGG
AAATCAATCGGTCACGGGCTCGGCGAGCCTTGGCAACACCGATGGCGCACGGGAACTGTATGACGACGTC
GGCCCCGAGGCGTTTGACGGCTTTCGCCACGCCGACGATGCCGCGCGGCGGCAGGCGGATGCAATTTTTT
CGCAGGCGCGGTTCTGGACGGGCTACAGCACCGTTCGCACCGCGCGATGCGGCCGGAACGTGCGCGTGGC
CGGCGCTGCATGGCGTCAGCATTGGCGCGATGAAGGCAGGGTACCGGATACGTTCCTGTTGACCGACGTC
GCACATGTCGGTGTCAACAATCTGCCTGAAACCGTGCTCGAGGCGCTCGAGCGCCGGCTGGGTCCACTGC
GGTTACCTGACGTCGATGCGCGTACGCTGAAGCAGGCGGAAGCCGGGGGTTATGCGAATCGCTTCGAGGC
CGTTCCGCGTGAACAGGTTTGGCGCCCGACGCTGGACGACGGCACCGGCCAGCGGTGGAATCCGGCACCG
ACAGCCATCGGGGCGCAGACCGCGATCGTCGTCGGTGCGCAGGGGGAAGCTGAGCCCGGTGCGAACGTTC
CGGTCCATACGGACGGGCAGGGGCGTATCCGGTTACGGTTTCACTGGCAGGCCGAAGGCGACAAGGGTAC
GTATCCGACGCGCGCGATGCAGCGTCTTGCCAGCGACGGGCATGGCTTGCAGCAGACCCCCCGCATCGGA
CAGGAAGTGCTCGTGCAGTTTCATCATGGGCTGATTCATCGCCCGATCGTCCTTGGCGGCCTGTTCAACG
GGCAGGGAGAGGGCGGCGATACGCCCACGCCGGGCGGCGCTGCCGCGCAGCCGGCCGATGCTTCCGTTTA
TGCGCAGGCGACCGATCTGGCGGCCAGCGGGCAAGGCAACGTGGCCGGTGGCAATAGTCCAATGTGGCAT
GGCGCGGGGGGCGGGGCGGACCGCCATGCGCATGCCGGCGCGCTGTCGGGCTTCAAGAGCCAGGGTTTCG
ACGGTCAGGGTGCGAACCAACTTGTCACGGACGACAGCGATGGCATGGGCCGCTTGCAGATGAGCACCAC
GCATGCGGCAACGCAACTCAATCTCGGCCATTTGCGCTATCAGGCAGACAACTATCTCGGCAGCTTCCGT
GGACAAGGCTTTGAAATACGCACGGATGCGTACGGCGCGTTGCGCGCGACGCGAGGCGCGCTGCTGACGA
GCTATGCACTGCGCTCCGGTCAGCCGGCGGGGGAGGCGTCGGCGTTGCAGGCGCTTTTTTCGCAGCAGGC
CGTGCTGGCCGAATCCCTCGACCGCGCGGCTGGCGAACACGGCACCTTGCCACTCGCTGCGCAACGCGGT
ACGCGACAGTCTGCCCGGTCGCGGCTCGACGCCGGAACTGTGCCGCTCAAGTCGCTCGAGCGAAGCCTGA
AAACGACCGTCGGTCAGGACGGGTTTTCGCAGGCGCTCAGTGATGCGAAGGATCGGACAGTCGGCAAACC
GCTTCCGCATACGGGCGATGCCCTGCTGGGCGTCGCTGCGCAGGGCGGGCATGGCATGCTGGCCGGGCAG
GGACTGCAATGGGCCGTGGGCGAAACGCTGACGCTCGGCAGCGGTGCCGACACGAACCTCGCGGTCAATC
AGACGCTGCGGATTCACAGCGGACAGGGCGTCGGCTGGCTGGCCGGTGCGCGTGCCGCGAACGGCGCCGG
CCTTACCGTGGTTTCAGGCCAGGACAACCTCGATCTGCAGGCGCAGCACGACGCGCTCGCGGTGCGTGCG
AAAGACGTCCTGAACGTGGCGTCGGCAAGCGCGAATGTCGAACTGATGGGCAAGACGACCGCGCATCTGG
CAGTCAGCGGCGGCGCGCACATTACGATCGAGGGCGGCAACGTCACGTTCGGGTGTCCCGGCAAGCTGGT
CATTCACGCCGCACAGCATCAGTTCGCCGGAGCGACCGATTTTCCCCGGGAACAAGGGAAGTGGGGCGAT
CTCGGGCAGTACAACGAGTACTACCATTTGCATGACGCCGCGACGGGCGAACCGTTGAAGAACCTGCCAT
ATCGCATGGTGGGTGAAGGCGGTGAAAAACTGGAGGGCATCAGTCGCGCGGGAGATGGACGGACGGCTAC
GTTCTCCACGCACTCGTCGTCGAAGCCGGTACGCGTCGAATACACGGGTAACGAGGACATCGAACATGGC
TGGTGA