SecReT6
Effector Protein ID: 171060757
-
SecReT6 ID265
T6SS typeA3
Gene symbol-
Locus tagLcho_4089
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4584916..4585401 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0085
DescriptionHcp protein
UniProt IDB1XXM2
KEGG IDlch:Lcho_4089
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-42, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|171060757|ref|YP_001793106.1| hypothetical protein Lcho_4089 [Leptothrix cholodnii SP-6]
MAVDMFIKIGDIKGESKDDAHKTEIDVLAWSWGLSQSGSAHMGGGAGAGKVSVQDISLTKYVDSSSTALI
VAACKGTHIKQATLTVRKAGDTPLEYIKITLDEVMVSSLSTGGSGGEDRLTENVTLNFAKFKVEYTIQAD
TGGKGTTSTAAWDIPANKPVG
-
Nucleotide Sequence: 486 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4585401-4584916 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGGCTGTAGACATGTTCATCAAGATCGGCGACATCAAGGGCGAGTCGAAAGACGACGCGCACAAGACCG
AAATCGACGTGCTGGCCTGGAGCTGGGGCCTGAGCCAGAGCGGCTCGGCGCACATGGGCGGTGGCGCGGG
TGCGGGCAAGGTCAGCGTGCAGGACATCTCGCTGACCAAGTACGTCGATTCGTCGTCCACCGCGCTGATC
GTGGCGGCCTGCAAGGGCACCCACATCAAGCAGGCCACGCTGACCGTGCGCAAGGCCGGCGACACGCCGC
TCGAATACATCAAGATCACGCTCGACGAGGTGATGGTGTCGTCGCTGTCGACCGGCGGCAGCGGTGGCGA
GGACCGCCTGACCGAGAACGTCACGCTGAACTTCGCCAAGTTCAAGGTCGAATACACCATCCAGGCCGAC
ACCGGCGGCAAGGGCACCACCAGCACAGCGGCCTGGGACATCCCGGCCAACAAGCCGGTGGGCTGA